KEGG   Oryctolagus cuniculus (rabbit): 100341052
Entry
100341052         CDS       T03373                                 
Symbol
NHLRC1
Name
(RefSeq) NHL repeat containing E3 ubiquitin protein ligase 1
  KO
K10602  E3 ubiquitin-protein ligase NHLRC1 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100341052 (NHLRC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341052 (NHLRC1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100341052 (NHLRC1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100341052 (NHLRC1)
SSDB
Motif
Pfam: NHL zf-RING_5 zf-RING_2 zf-RING_UBOX Prok-RING_4 zf-C3HC4_3 Baculo_IE-1 zf-C3HC4_4 zf-C3HC4 zf-RING_11 zf-C3HC4_2
Other DBs
NCBI-GeneID: 100341052
NCBI-ProteinID: XP_008272339
Ensembl: ENSOCUG00000003851
UniProt: G1SKJ1
LinkDB
Position
Un
AA seq 389 aa
MGAEAAEARPALRELVREAETSLLECKVCFERFGHRQQRRPRNLPCGHVVCLACVAALAH
PRTLALECPFCRRACRGCDTSDCLPVLHLLELLGSALRPSPAAQRAGPSAPGALSCHQAF
GGWGTLVNPTGLALCPKTGRVVVVHDGKRRVKIFDSAGGCAHQFGEKGDAAQDVKYPLDV
TVTNDCYVVVTDAGDRAIKVFDFFGQIKLVLGGQFSLPWGVETTPQNGVLVTDAEAGSLH
LLQIDFAEGLLRGSQLLQASLCSPRGVAVSWLTGAVAVLERLAGSARVKVFSSRMQLLSQ
VDTFGLSLFHPPRIVASAVTFDHQGNVVVTETSGPAVLCLGKPEEFPVVKPMISHGLGHP
VALAFTKENSLLVLDSASHSVNVYKADWG
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgggggccgaggccgcggaggcccggccggcgctgcgggagctggtgcgcgaagccgag
accagcctgctggagtgcaaggtgtgctttgagaggttcggccaccgtcagcagcggcgg
ccgcgcaacctgccctgtggccacgtggtctgcctggcctgcgtggccgcgctggcgcac
ccgcggacgctggccctcgagtgccccttctgccggcgagcctgccgcggctgcgacacg
agcgactgcctgccggtgctgcacttgctggagctgctgggctccgcgctgcgcccgtcg
ccagctgcccagcgcgccggccccagtgcgccaggggccctcagctgccaccaagccttc
gggggctgggggacgctggtcaaccccaccgggctggcgctgtgccccaagacggggcgg
gtcgtggtagtgcacgacggcaagaggcgggtcaagatctttgactccgcgggagggtgc
gcgcatcagtttggggagaaaggggacgctgcccaggatgtcaagtaccccttggatgtc
accgtcaccaacgactgctacgtggttgtcaccgacgccggcgaccgcgccatcaaagtg
ttcgacttttttggccagatcaagctggtgctcgggggccagttctccttgccctggggc
gtggagaccaccccgcagaacggcgtcctggtcactgacgccgaggcagggtccctgcac
ctcctgcaaatcgactttgccgaggggctcctccgcggatcgcagctcttgcaggcgtct
ctgtgcagccctcgcggggtggccgtgtcctggctcaccggggccgtggccgtgctggag
cggctggccggcagcgccagggtgaaggtgttcagttccaggatgcagctcctcagccag
gtggacacctttgggctgagcctcttccaccctccccggatagtcgcctcggccgtgacc
tttgatcaccaggggaatgtggtcgtcacagagacctctggtcccgctgtcctgtgccta
ggaaaacccgaggagttcccagtcgtgaagcccatgatcagtcacgggcttggccacccc
gtggcgctggccttcaccaaggagaattcgcttctcgtgctggactctgcatcccactct
gtcaacgtttataaagctgactggggctga

DBGET integrated database retrieval system