KEGG   Oryctolagus cuniculus (rabbit): 100341083
Entry
100341083         CDS       T03373                                 
Symbol
ELOC, TCEB1
Name
(RefSeq) elongin C
  KO
K03872  elongin-C
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04066  HIF-1 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100341083 (ELOC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100341083 (ELOC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100341083 (ELOC)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100341083 (ELOC)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341083 (ELOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341083 (ELOC)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100341083 (ELOC)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Adoptor protein
     100341083 (ELOC)
   Cul5 complex
     100341083 (ELOC)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100341083 (ELOC)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 100341083
NCBI-ProteinID: XP_017196894
UniProt: A0A5F9CJC1
LinkDB
Position
3:complement(89692411..89720985)
AA seq 112 aa
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt   +upstreamnt  +downstreamnt
atggatggagaggagaaaacgtatggtggctgtgaaggccctgatgccatgtatgtcaag
ttgatatcttctgatggtcatgaatttattgtaaaaagagaacatgcactaacatcagga
acaattaaagccatgttgagtggcccaggtcagtttgctgaaaacgaaaccaatgaggtc
aattttagagagatcccttcacatgtgctatcaaaagtgtgcatgtattttacctacaag
gttcgctacactaacagctccaccgagattcccgaattcccaattgcacctgaaatcgca
ctggaactgctgatggctgcgaacttcctagattgttaa

KEGG   Oryctolagus cuniculus (rabbit): 100355441
Entry
100355441         CDS       T03373                                 
Name
(RefSeq) transcription elongation factor B polypeptide 1-like
  KO
K03872  elongin-C
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04066  HIF-1 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100355441
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100355441
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355441
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100355441
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355441
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100355441
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100355441
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Adoptor protein
     100355441
   Cul5 complex
     100355441
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100355441
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 100355441
NCBI-ProteinID: XP_017197105
LinkDB
Position
3:147471036..147478685
AA seq 103 aa
MKKGNKTYGGCEGPDAMYVKLVSSDGHELIVKRKHTLRSGAIKAALSGPDQFAENETNEA
YCKEIPSHMLSKLCMYFTYKIHCTYSSTEIPEFQIAPEILWNC
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaaaaaaggaaataaaacctatggtggctgtgaaggccctgatgccatgtatgtcaag
ttggtatcttctgatggtcatgaattgattgtaaaaagaaaacatacactaagatcagga
gcaattaaagccgcgttgagtggcccagatcagtttgctgaaaatgaaaccaatgaggcc
tattgtaaagagatcccttcacatatgctatcaaaactatgcatgtattttacctacaag
attcactgcacttacagctccactgagattcctgaattccaaattgcacctgaaatccta
tggaactgctga

DBGET integrated database retrieval system