KEGG   Oryctolagus cuniculus (rabbit): 100341119
Entry
100341119         CDS       T03373                                 
Symbol
SSH2
Name
(RefSeq) slingshot protein phosphatase 2
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100341119 (SSH2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100341119 (SSH2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100341119 (SSH2)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100341119 (SSH2)
    3.1.3.48  protein-tyrosine-phosphatase
     100341119 (SSH2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    100341119 (SSH2)
SSDB
Motif
Pfam: DSPc DEK_C Y_phosphatase Hormone_3
Other DBs
NCBI-GeneID: 100341119
NCBI-ProteinID: XP_002718952
Ensembl: ENSOCUG00000016601
UniProt: G1TG78
LinkDB
Position
19:18292748..18576002
AA seq 1419 aa
MALVTVQRSPTPSTTSSPCASEADSGEEECRSQPRSISESFLTVKGAALFLPRGNGSSTP
RISHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRYMVVVSTNGRQDTEE
SIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHLDGDGGFSVSTDNRVHIFKPVSVQAMWSA
LQSLHKACEVARMHNYYPGSLFLTWVSYYESHINSDQSSVNEWNAMQDVQSHRPDSPALF
TDIPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIV
ILGQMDSPTQIFEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVY
DEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYD
YVKERRTVTKPNPSFMRQLEEYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELN
RKEITTSADQIAEVKTVEGHPPIPPVFVEHVVPQDANQKGLCTKERMICLEFTSREFHAG
QIEDELNLNDINGCSSGCCLNESKFSLDNCHASKALIQPGQAPEVASKFPDLTVEDLETD
ALKADMNVHLLPMEELTSRLKDLPMSPDPESPSPQPRCQTEISDFSTDRIDFFSALEKFV
ELSQETRCRSFSHSRMEELGGGRGESCRLSVVEGAPSEATTDDQRSSSLSNTPHASEESS
MDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILSNTCHTP
KKNTTHERALAPENKPGHLEQDEGLYTAQPELAKDSGKCNLEGCLTTHPSTADLEEEEPV
EGEQEPRGPGTHSGAKWYAGSVRRATLEFEERLRQEQEHHGAAPACTSLSTRKNSKNDSS
GADLAPKGRSDETTPEHLFAPKESEMNKSKEKCSGPEAGSLSHCERNAIALALKPLEFQL
LPAPQECPGSDSRTKQEGVLKEQRAVVSHQGTDTQAAPAPLPKRIEIIEYTHTATLPSHA
GPGGEAVTSKESGEQRLRNVKVEKAITVLCTLDENLNRTLDPSQFALRPQVLPLPHSSSP
GHDRPTDPTSVLSSPEVRDKSPLTALETAAPCVSRTTHVPSASLDFLHPQTVVHLEGCTE
QSSTTDNEPSAEQVGWEETQEVPLSCGSEAPHTGSQLSSEDLSLISKLSDNVRESREKLD
LSPVAFRLPHSSSSENIKGLSSSPGVVRELTQEIESRVVFQAGRTKPPGMRRSASLAKLG
YLDLCKDCLPEGEPGSSTTPHLKLRQPFLRTDSGTHAPEAREPPEDPGALRNPEPTKHFV
EQLRTTECIAQSKPVERPLVQYAKEFGSSQQCLLPRAGLELTSSEGGLPLLQTQGLQCTG
PAPVLAVAPRQQHGRTHPLRRLRKANDKKRTTNPFYNTM
NT seq 4260 nt   +upstreamnt  +downstreamnt
atggctttggtcacggtccagcggtcgcctacccccagcaccacctccagcccctgcgcc
tcggaggcagacagtggggaagaagaatgccggtcacagcccaggagcatcagcgagagc
tttctaactgtcaaaggtgctgctctttttctgccacggggaaatggctcatccacacca
agaatcagccacagacgcaacaagcatgcaggcgatctccagcagcatctccaagcaatg
ttcatattactccgcccggaagacaacatcaggctggctgtaagactggaaagtacttac
cagaatcgaacacgctatatggtagtggtttcaactaatggtagacaagacactgaagaa
agtattgtcctaggaatggatttctcctctaacgacagtagcacttgtaccatgggctta
gtccttcctctctggagtgacaccctaattcatttggatggtgatggtgggttcagcgta
tcaacagataacagagttcacatattcaaacctgtgtctgtacaggcaatgtggtccgca
ctacagagtttacacaaagcttgtgaagtggccagaatgcataactactacccagggagc
ctatttctcacttgggtgagttattatgagagccatatcaactcagatcagtcctcagtc
aatgaatggaatgctatgcaggatgtgcagtctcaccgacccgactctccagctctcttc
acagacataccaactgaacgagagcgaacagaaaggctaattaaaaccaaattaagggag
attatgatgcaaaaagatttggagaatatcacatccaaagagatacgaacggagttggag
atgcagatggtgtgtaatttgcgggaattcaaggaatttatagataatgaaatgatagtg
atccttggtcagatggatagccctacacagatatttgagcatgtgttcctgggttcagag
tggaatgcctcaaatctagaggacttgcagaaccgaggggtacggtatatcttgaatgtc
actcgagaaatagataactttttcccaggagtctttgaatatcataacatccgggtatat
gatgaagaagcaacagacctcctggcttactggaatgacacgtacaaattcatctctaaa
gcaaagaaacatggatctaaatgtcttgtacattgcaagatgggggtgagccgctcagcc
tccactgtaattgcctatgcaatgaaggaatatggctggaatctggatcgagcctatgat
tatgtgaaggaaagacgaacggtgaccaaacctaaccccagcttcatgagacaactggaa
gagtatcaggggatcttgctggcaagcaaacaacggcataacaaactctggagatctcat
tcagacagcgacctctcagaccaccacgagcccatctgcaaacctgggctggagctcaac
aggaaggagatcaccacctcagcagaccagattgccgaggtgaagaccgtggagggtcac
ccacccatacctcctgtcttcgtggaacatgtggtcccacaggatgcaaatcagaaaggt
ctgtgtaccaaagaaagaatgatctgcttggagttcacttcgagggaattccatgctgga
cagattgaagatgaattaaacttaaatgacatcaatggatgctcatccggatgttgtctg
aatgaatcaaaattctctcttgacaactgccatgcgtcgaaagccttaatccaacctgga
caggctccagaagtggccagcaagttcccagacctaacagtagaagatctggagacagat
gcactgaaagcagacatgaatgtccacttactacctatggaagaattgacatctcgactt
aaagacctccccatgtcccctgatcccgagtcaccaagcccccaacccagatgccagact
gaaatctcagatttcagtactgatcgcattgatttttttagtgccctagagaagtttgta
gagctctcccaagaaacccggtgccgatctttttcccactcaagaatggaagaactgggt
ggaggaaggggtgagagttgtcgactgtcagtggtagaaggagccccttccgaagcaacc
actgatgaccagagaagtagctctttgagtaatactccccacgcatctgaagaatcttca
atggatgaagaacagtcaaaggcaatctcagaactggtcagcccagacatcttcatgcaa
tctcactcagaaaatgcaatttcagtcaaagaaattgtcactgaaattgagtccatcagt
caaggagttggacagattcaactgaaaggagacatcctatccaacacatgccatacgcca
aagaagaacaccacccatgagagggccctggctccagagaataaacctggacatctggag
caggatgagggtctctacacagcccagcctgaactagccaaagactcagggaagtgcaac
ctggaaggctgcctaaccactcacccatccacagcagacttggaggaagaagaaccagtt
gagggagaacaagagcccaggggcccagggacacattctggtgccaagtggtacgctggg
tctgtgaggcgagccaccttagagtttgaagagcgcttacggcaggaacaagagcaccat
ggtgctgcccctgcgtgtacctcattgtccactcgcaagaattccaagaatgattcttct
ggggcagacctagcacccaaagggagaagtgatgagaccaccccagaacatttatttgcc
cccaaggaatcagagatgaacaagagcaaagagaagtgcagtgggcctgaggctggctcc
ctgtcccactgtgagcggaatgccattgctctggcactcaagccgctggagttccagctc
ttgccagctcctcaggagtgcccaggctcagacagcagaacaaagcaggaaggagtcctg
aaagagcagagggctgtagtttcgcaccagggaactgacacacaggcagcccctgccccc
ctccccaagaggatagagatcattgagtatacccacacagctaccttacccagtcacgct
gggccgggaggggaagcggtcaccagcaaagagagtggggagcaaagactgaggaatgtg
aaagtggagaaggccatcactgtgctctgcacacttgatgaaaatctgaacaggactctg
gaccccagccagtttgctctgcgcccccaagtgctacctctgcctcattcttcctcacct
gggcatgacaggcccactgatccaacctctgtgctgagcagccctgaagtcagggacaag
agcccgttgacagccctggagacagcagccccttgtgtcagtcgcacaacccacgtacca
tctgccagcttagatttcctgcatccccagactgtggttcacctggaaggctgcacggag
caaagcagcaccacagacaatgagccctctgcagagcaggttggctgggaagaaacgcaa
gaggtccccctctcttgtggcagtgaagcgccacacacgggctcccagttaagtagtgaa
gatctaagtttaattagcaaacttagtgacaacgttagggagtcacgggaaaaactggac
ctgtcacctgtagcttttcggctcccacatagctcgagtagtgaaaatatcaaaggtctc
agcagcagccccggcgtggtgagggagctcactcaagaaatcgagtcccgcgtggttttc
caggcagggcgcaccaagccaccggggatgaggcgctcagcttcgctcgccaagctgggt
tacttggacctctgtaaggactgtttaccagagggggagcctggctcctccacaactcct
catctcaaactgcgccagcccttcctcagaacagactcaggcacacacgccccggaggcc
cgggagcccccagaagatccaggcgccctgcggaaccccgagcccaccaagcattttgta
gagcaactcagaacaacagagtgtatcgcacagagcaagccagtggagaggccccttgtg
cagtatgccaaagaattcggttccagccagcagtgtttgctccccagggcaggactggaa
ttgactagttctgaaggaggccttcctttgctacagacccagggactgcagtgcacaggc
ccagccccagtgctggccgtggctccccgtcagcaacatggcagaactcacccgcttagg
agactgagaaaggcaaatgacaaaaaacggacaaccaaccccttctataacaccatgtga

KEGG   Oryctolagus cuniculus (rabbit): 100353500
Entry
100353500         CDS       T03373                                 
Symbol
SSH3
Name
(RefSeq) slingshot protein phosphatase 3
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100353500 (SSH3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100353500 (SSH3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100353500 (SSH3)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100353500 (SSH3)
    3.1.3.48  protein-tyrosine-phosphatase
     100353500 (SSH3)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    100353500 (SSH3)
SSDB
Motif
Pfam: DSPc DEK_C Y_phosphatase PTPlike_phytase
Other DBs
NCBI-GeneID: 100353500
NCBI-ProteinID: XP_008271956
Ensembl: ENSOCUG00000006393
LinkDB
Position
1:194761919..194767557
AA seq 673 aa
MALVTVSRSPPASGHSTPVGPTARASKQRSRLQRRQSFAMLRGAVLGLQDNGDNDGDNAA
SEASLELGEEQPHREHTDGDHTDGHGPQKQAQRQHLHLMVELLRPQDDIRLAAQLEAARP
PRLRYLLVVCTREPPSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGGFSVT
SGGQSRIFKPISIQTMWATLQVLHQACEAALGGGLVPGGSALAWATHYQERLDSDQGSLN
EWMAMADLESLRPPSAEPGRPLEQQQMEQAIRAELWKLLDASDLESITSKEIRQALEQRL
GCPLQQYRDFIDNQMLLFVAQQDRASRIFPHLYLGSEWNAANLEELQRNRVSHILNMARE
IDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFIEDARAQGTRVLVHCKMGVSRSAATV
VAYAMKQYSWSLEQALRHVQELRPVVRPNPGFLRQLQTYQGILTASRQSHIWEQKVGGAS
LEEPLAPEVSTPLPPLPPEPGGSGEAKALVLEESQAGPRPRINLRGVMRSISLLEPPSEL
EGVLGDSELPEVFPAQESSDEEPCPQLSRAKGDQWAHRRPWPALKSRQSVVALQSAALVA
SRTQAFQEQGQVEAGTSSTPRLRKVVRQARVDDSRGEDEGSAACGPATSLSAPPQVAPDP
GVEASPPRPQTPV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggccctggtcacagtgagccgctcgcccccggccagcggccactccacgcctgtgggg
cccacggcccgggccagcaagcagagaagcaggctccagcgcaggcagagctttgcaatg
cttcgcggggcagtcctgggactgcaagacaacggggacaatgacggggacaatgccgcc
tcagaggccagcctggagctgggtgaggagcagccccacagggagcacaccgacggggac
cacaccgacgggcacggaccccagaaacaggcgcagaggcagcacctgcacctcatggtg
gagctgctgaggccgcaggacgacatccgcctggcggcccagctggaggcggcccggccc
ccgcggctccgctacctgctggtggtttgcacgcgagaacctccaagccaggatgagacc
gtcctcctgggggtggattttccggacagcagctcccccagctgcaccttgggcctggtc
ttgcccctctggagtgacacccaggtgtacctggacggagatgggggcttcagcgtgact
tccggggggcagagccgcatcttcaagcccatttccatccagactatgtgggccacgctc
caggtgttgcaccaagcttgtgaggcggctctgggtggcggcctcgtgcctggtggaagt
gcccttgcctgggccacccactaccaggagagactggactctgaccagggcagcctcaat
gagtggatggccatggccgacctggagtctctgcggcctcccagcgctgagcctggccgg
cccctagaacagcagcagatggagcaggcgatccgggccgagctgtggaagctgctggac
gccagtgacctggagagcatcacttccaaggagatccgccaggccctggagcagcgcctg
ggctgccccctccagcagtaccgcgacttcatcgacaaccagatgctgctgtttgtggcc
cagcaggacagggcctcgcgcatcttcccgcacctctacctgggctccgagtggaatgcg
gcgaacctggaggagctgcagagaaacagggtcagccacatcttgaacatggcccgggag
atcgacaacttctaccccgagcgcttcacctaccacaacgtgcgcctctgggatgaggag
tcggcacagctgctgccgcactggaaggagacgcaccgcttcatcgaggatgccagagcg
cagggcacccgcgtgcttgtccactgcaagatgggcgtcagccgctcagccgccacggtg
gtggcctacgccatgaagcagtacagctggagcctggagcaggccctgcgccacgtgcag
gagctccggcccgtcgtgcgccccaaccccggcttcctgcgccagctgcaaacctaccag
ggcatcctgaccgccagccggcagagccacatctgggagcagaaagtgggtggggcctcc
ctggaggagcccctggctcccgaagtttctacaccattaccgccccttccgccagaacca
gggggcagcggggaggcgaaggctctggtcttggaggagagccaggcagggccacggccc
cgcatcaacctccgcggggtcatgcgatccatcagtctcctggagcccccctctgagctg
gagggtgtcctgggggacagcgagctgccagaggttttccctgcccaggagtcttcagac
gaagagccctgccctcagctctcgagggccaagggagaccagtgggcccacaggaggccg
tggcctgccctgaagtcccgccagtctgtggtcgccctccagagcgctgccctggtggcc
agccggacccaggccttccaggagcaggggcaggtggaggccggcacgtcctccacaccc
cgcctgcggaaggtggtgaggcaggcccgcgtggacgacagcagaggcgaagatgagggc
tctgctgcctgtggacctgccacatccctctcagctcctccccaggtggccccagacccc
ggcgtggaagcctcaccaccacggccccagaccccggtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100356755
Entry
100356755         CDS       T03373                                 
Symbol
SSH1
Name
(RefSeq) slingshot protein phosphatase 1
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100356755 (SSH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100356755 (SSH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100356755 (SSH1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100356755 (SSH1)
    3.1.3.48  protein-tyrosine-phosphatase
     100356755 (SSH1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    100356755 (SSH1)
SSDB
Motif
Pfam: DSPc DEK_C Y_phosphatase
Other DBs
NCBI-GeneID: 100356755
NCBI-ProteinID: XP_017193552
Ensembl: ENSOCUG00000013433
LinkDB
Position
Un
AA seq 1025 aa
MALVTLQRSPTPSAASSSASNSELEAGSDEERKLNLSLSESFFMVKGAALFLQQGSSAQG
QRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSNGRQDTE
ENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWS
ALQVLHKACEVARRHNYFPGGVALIWATYYESCIGSEQSCINEWNAMQDLESTRPDSPAL
FVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRTELEKQMNCNLKEFKEFIDNEML
LILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRV
YDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAY
NYVKQKRSITRPNAGFMKQLSEYEGILDASKQRHNKLWRPQPESSLQQPADEPAGPSDFL
PEALDDATEAQLPCVGDATQPAFASSRLPGGPTLPCCFRRLSDPLLHSPDEEADGLVQLE
DLERDALLEGAAQPPEAPRPARQPQESPAPCEKDVKKRLEFGSPKTRSGSLPQVEEMDRD
EGPGAGRWGHPPSPLNRENLNNNNSKRSCPDDFEHDAIFGILNKVKPPYKSCANCMYPTA
SGAPEAFREPHEDPSAGAICTQPAFLPHVTSSPVTHATGRCKTLEKPASGPAETSPVLPA
TGPRRPDGNGLGARATPELPVSLLEPSRETLKVLPKLPLLLKNPHCDQSLPCTEGAREEP
SPKKDPRPTKDLRLLLFGGDSERPPPTSYLMQHQESIIQLQKAGLVRKHTRELERLKGSP
ADGLAGRLEASIPEGSQEPAAPHAPDGALLRSPPAFLGRLDHTSSFSKDFLKTVCYTPTS
SAVSSSLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLAKLGSL
DFSTEDLSSEADISAAAADSQDAKPSNSSFLHEPQATPRSPAATRKASGKSAPEDLRSPC
RASKS
NT seq 3078 nt   +upstreamnt  +downstreamnt
atggccctggtgaccctgcagcgttcgcccacgcccagcgccgcctcctcctcggccagc
aacagcgagctggaggctggcagtgatgaggagcgaaagttaaacctcagcctgagcgag
agctttttcatggtgaaaggagcagccctcttcttgcaacaggggagcagtgcccaaggc
cagcggagtcttcagcacccccacaagcatgcaggtgacctgccccagcatctgcaagta
atgatcaacctcctgcgctgtgaagacagaatcaagctggccgtgcgcctggagagcgcc
tgggcggaccgcgtgcggtacatggtggtggtgtacagcaatgggcgccaggacaccgag
gagaacatcctgctgggagtggacttctccagcaaggagagcaaaagctgcaccattggg
atggttctacgactgtggagcgacacgaaaatccacctggatggagacggagggttcagc
gtgagcaccgctgggaggatgcacatcttcaagcccgtgtccgtacaggccatgtggtct
gccctgcaggtccttcacaaggcctgcgaagtggctcggagacacaactacttccccggg
ggcgtggccctcatctgggccacctactacgagagctgcatcggctcggagcagagctgc
atcaacgagtggaatgccatgcaggacctggagtccacccggcccgactccccagccctg
ttcgtggacaagccaaccgaaggggaacggactgagcgcctcatcaaagccaagctccga
agcatcatgatgagccaggatctggagaacgtgacctccaaggagatccggaccgagtta
gagaagcagatgaactgtaacttgaaagaattcaaggaattcatagacaacgagatgctg
ctcatcttggggcagatggacaagccctcccttatcttcgaccatctttatctcggctca
gaatggaatgcatccaacctggaggaactgcagggctcaggggttgactacatcttaaat
gtcaccagagaaatagataacttcttccccggcttatttgcctatcacaacatccgtgtc
tatgacgaggagaccacagacctgctggcccactggaacgaagcgtatcacttcataaac
aaagccaagaggaaccactccaagtgcctggtccactgcaagatgggtgtcagccgctcg
gcgtccacggtcatcgcctacgccatgaaggagttcggctggcccctggagaaggcgtac
aactacgtgaagcagaagcgcagcatcacccggcccaacgcgggcttcatgaagcagctg
tccgagtacgagggcatcctggacgccagcaaacagcggcacaacaagctgtggcgcccg
cagccagagagcagcctccagcagcctgcagacgagcccgcgggccccagtgacttcttg
ccagaggccctggatgacgccacggaagcccagctgccctgcgtgggcgatgccacccag
cccgcgttcgccagcagcaggctcccgggagggcccacgctcccttgctgcttccggcgg
ctctcagaccccctgttacattccccggatgaggaagcggacggcttggtccagctcgag
gatctagagagggatgcgctcctggagggtgctgcgcagccgcctgaggcgccccggccg
gccagacagccccaggagagccctgccccctgtgagaaggacgtgaagaagaggctagag
tttgggagccccaagacgcggagtggctccctcccgcaggtggaggagatggacagggac
gagggcccaggagctgggaggtggggccaccccccaagtccgctcaaccgggagaaccta
aataataacaacagcaagaggagctgcccggatgacttcgagcatgacgccatatttggg
atcctgaacaaagtgaagccaccctataaatcctgtgccaactgcatgtaccccacggcc
agcggggctcccgaggccttcagggagccacatgaggacccaagcgccggcgccatctgc
acgcagcccgccttcctgccccatgtcacctcttcccctgtgacccatgccaccggcaga
tgcaaaaccctggagaagccagcctctggcccagctgaaacgtccccagtcctcccagcc
actggcccaaggcggccggacggcaatggccttggggcccgggccaccccagagttgcca
gtcagccttttggaaccttccagagagaccctgaaggtccttccaaagctgcccctcctc
ttgaagaatcctcactgtgatcagagccttccctgcacggaaggggcgagggaagagccg
tcgcccaagaaagacccgaggcccaccaaggacctgcggctgcttctgttcggcggtgac
tcggagaggccaccgcccaccagctacctgatgcagcaccaggagtccatcatccagctg
cagaaggccggcctcgtccgcaagcacaccagggagctggagcggctcaagggctcgccg
gcggacggcctggccggcaggctggaggccagcatccccgaggggagccaggagccggct
gcgccccatgcgccagacggagccttgctgaggagccccccggccttcctgggccgcctg
gaccacaccagtagcttctcgaaggacttcctgaagaccgtgtgctacacgcccacctcg
tcggccgtgagctccagcctgacccgcagttccagcagcgacagcatccacagcgtccgc
gggaagccggggctggtgaagcagcgcacgcaggagatcgagacgcggctccggctggcg
ggcctcaccgtctcgtcgccgctgaagcgctcccactcgctggccaagctcgggagcctg
gacttttcgacagaagacctgtccagcgaggccgacatatccgctgccgccgccgactct
caggacgccaagcccagcaactcttccttcttgcatgagccccaggccacgccacgcagc
ccggccgccacccgcaaagcatcagggaaatctgcccccgaggacttgagaagcccctgc
cgggcgagcaagagctga

DBGET integrated database retrieval system