KEGG   Oryctolagus cuniculus (rabbit): 100341127
Entry
100341127         CDS       T03373                                 
Symbol
RUFY1
Name
(RefSeq) RUN and FYVE domain containing 1
  KO
K12482  RUN and FYVE domain-containing protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341127 (RUFY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341127 (RUFY1)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    100341127 (RUFY1)
SSDB
Motif
Pfam: RUN FYVE zf-RING_5 YabA HypA IBR ATG16
Other DBs
NCBI-GeneID: 100341127
NCBI-ProteinID: XP_002721347
Ensembl: ENSOCUG00000002518
UniProt: G1SHR3
LinkDB
Position
Un
AA seq 701 aa
MADREDGSPAGREPEPESESGPGSEPGEDFEIVDRGQLPSPGALRSAAKAAEGWSAPILT
LARRATGNLSASCGNALRAAAGLGGTDGGADGAARAASKGQMMEERANLMHMMKLSVKVL
LQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEA
AEIATSVRNLPELKTPVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEE
EGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSIYLRDVQDLDGGKEHERITDVLDQ
KNYVEELNRHLSCTVGDLQAKIDGLEKTNSKLQEELSAATDRICSLEEEQQQLREQNELI
RERSEKSVEMTKQDTRVELETYKQTRQGLDEMYSDVWKQLKEEKRIRLELEKELELQIGM
KTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKVQDAESSLQQKNEAITSF
EGKTNQVLSSMKQMEERLQLSDQARRGAEERSRKLQQELGSRVGALQLQLSQLHEQCSSL
EKELKSEKEQRQALQRELQHEKDTCSLLRTELQQVEGLKKELRGLQDEKAELQKVCDEQE
QALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLKDDEATHCKQCEKEFSIARRKHHCRNC
GHIFCSTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggccgaccgggaagacggctccccagcggggcgggagccggagccggagtcggagtcc
gggccggggtctgagccgggagaagacttcgagatcgtggaccgcggccagttgccgagc
ccgggcgcgctgcggagcgcggccaaggcggccgagggctggtcggcgcccattctgacc
ctggcgcgacgggccaccgggaacctgtcggcgagctgcgggaacgcgctgcgcgcggcc
gcggggctgggcggtacggacggcggcgcggacggggcggcgcgcgcagcgtccaagggc
cagatgatggaggagcgagccaacctgatgcacatgatgaaacttagcgtgaaggtcttg
ctgcagtccgccctgagcctgggccgcagcctggacgccgaccatgcccccttgcagcag
ttcttcgtggtgatggagcactgcctcaaacacgggctgaaagttaagaagagttttatt
ggccaaaataaatctttctttggtcctttggagctcgtggagaaactttgtccagaagcg
gcagagatagctactagtgtcagaaatctgccagaattaaagacacctgtggggagaggc
agagcttggctttatcttgcactcatgcaaaagaaactggcagattatctgaaagttctt
atagacaataaacatctgttaagtgagttctacgagcccgaggcactcatgatggaggaa
gaaggcatggtgattgtcggcctgctggtgggactcaatgttctcgatgccaatctctgc
ctaaaaggagaagacttggattctcaggttggagtgattgacttttccatctacctcagg
gatgtgcaggatcttgacggaggcaaagaacatgaaagaattactgatgtccttgatcaa
aaaaattacgtggaagaacttaaccggcacttaagctgcacggttggagatcttcaagca
aaaatagatggcttagaaaagactaattcaaagctccaagaagagctttcagcggcaact
gaccggatttgctcacttgaagaagagcagcagcagttaagagaacaaaatgaattgatc
cgtgaaagaagtgagaagagtgtggagatgacaaaacaagataccagagtggagctggag
acctacaagcagacccggcaaggcctggatgaaatgtacagcgacgtgtggaagcagctc
aaggaggagaagcggatccgactggaactagaaaaagaactggaattacaaataggaatg
aaaacggagatggaaattgcaatgaagttactggagaaggatacccacgagaagcaggac
accctcgtcgccctccgccagcaactggaagaagtcaaagcaattaatttacagatgttt
cacaaagttcaggatgctgagagcagtttgcagcagaagaatgaagccatcacatctttt
gagggtaaaaccaaccaagttctgtccagcatgaagcagatggaagaaaggttacagctc
tcagaccaggcgagacggggcgctgaggagcggagccgtaagctgcagcaggagctgggc
agccgggtgggcgccctgcagctgcagctctcccagctgcacgagcagtgctcaagtcta
gagaaagagttgaaatcagaaaaagaacagagacaagctctccagcgggaattacagcac
gagaaggatacctgctctctcctgcggacggagctgcagcaagtggaaggactgaaaaag
gagctgcgggggctccaggacgagaaggccgagctacagaaggtgtgtgatgagcaggag
caagccctccaggaaatgggactgcacctcagccaatccaagttgaagatggaagacata
aaagaagtaaacaaggccctgaaggggcacacgtggctgaaagatgacgaagccacacac
tgtaagcagtgcgagaaggagttctccatcgcccgcagaaagcaccactgccgcaactgt
ggccacatcttctgcagcacctgctccagcaacgagctggccctgccctcctaccccaag
cccgtgcgcgtgtgcgacagctgccacacgctgctgctgcagcgctgctcctccacggcc
tcctga

KEGG   Oryctolagus cuniculus (rabbit): 100347928
Entry
100347928         CDS       T03373                                 
Symbol
RUFY2
Name
(RefSeq) RUN and FYVE domain containing 2
  KO
K12482  RUN and FYVE domain-containing protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347928 (RUFY2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347928 (RUFY2)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    100347928 (RUFY2)
SSDB
Motif
Pfam: RUN FYVE YabA Trimer_CC bZIP_1 zf-RING_5 zf_C2HC_14 Crescentin
Other DBs
NCBI-GeneID: 100347928
NCBI-ProteinID: XP_002718500
Ensembl: ENSOCUG00000004449
UniProt: A0A5F9DDN4
LinkDB
Position
18:18259500..18302448
AA seq 641 aa
MTFQVWGWRREDASQASAWVPDAEGGRGRAMPGKTLATKDPTAVERANLLNMAKLSIKGL
IESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVRKSFLSYNKTIWGPLELVEKLHPEA
EEIGASVRDLPGLKTPLGRARAWLRLALMQKKMADYLRCLIIQRDLFSEFYEYHALMMEE
EGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNEEDIGNKERNVQIAAILDQ
KNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEELAIAKNNIIKLQEENHQLRSENKLI
LMKTQQHLEVTKVDVETEVQTYKHSRQGLDEMYSEARRQLRDESQLRQDVENELAVQVSM
KHEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSEDGLKEKNEIIARL
EEKTSKITAAMRQLEQRLQQAEKAQMEAEAEDEKYLQECLSKSDSLQKQISQKEKQLVQL
ETDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQMASLKKEFLSLQDENQQLKKICHEQE
QALQELGNKLSESKLKIEDIKEANKALQGLVWLKDKEATHCKLCEKEFSLSKRKHHCRNC
GEIFCNACSDNELPLPSSPKPVRVCDSCHAMLIQRCSSNVP
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgactttccaggtttgggggtggcggagggaagacgcgtctcaggcttccgcctgggtg
cccgacgccgagggagggcgagggcgagccatgccgggcaagacgctggctacaaaagac
cccacagctgtcgagcgagcaaacttgctaaacatggctaaactgagtatcaaagggctc
attgaatcggctctgagctttggccgcaccctggattctgactaccctcccttgcagcag
ttctttgtcgttatggagcattgtctgaaacatggtcttaaagtaagaaaatcatttttg
agttacaacaaaaccatctggggccctttggagctggtggagaagctgcatccagaagca
gaggaaataggagccagtgtccgggacttacctggtcttaagacccccctgggtcgtgca
agagcatggcttcggttagccctcatgcaaaaaaagatggccgattacctgcgctgctta
attattcagagggatctctttagcgagttctatgagtatcacgcactgatgatggaagag
gaaggagcagtgattgtggggctgctggttggcctgaacgtgatcgatgcgaacctgtgt
gtgaagggagaggatttagactcacaggttggagtgattgacttttccatgtacttaaag
aatgaagaagatattggaaataaagaaaggaatgttcaaattgctgccatattagatcaa
aagaattacgttgaagaattaaataggcaactgaacagcacagtcagcagccttcattcc
agagtggattcattagaaaagtcaaataccaagctgattgaagagttggctatcgcgaaa
aataatatcattaaactgcaagaagaaaatcatcagttacgaagtgaaaataaattgatt
ttaatgaaaacacagcagcacctagaggtcacaaaagtggatgtggaaactgaggtgcag
acgtacaagcattctcggcaggggctggatgagatgtacagtgaggccaggagacagctt
cgagatgagtctcagctaagacaggatgtggagaatgagctagctgtacaagtaagcatg
aaacatgagattgaacttgccatgaagttgttggagaaagatatccacgagaaacaagat
actttgataggccttcgacaacaactagaggaagttaaagcaattaacatagagatgtat
caaaagttgcagggttctgaagatggcttaaaagaaaaaaatgaaataattgcccgacta
gaggaaaaaaccagtaaaattactgcagccatgaggcagctggaacaaagattgcagcaa
gcagagaaggcgcaaatggaagctgaagctgaagatgagaaatatctacaagaatgtctg
agtaaatccgacagtctgcagaaacagatctcccagaaggagaaacagctggttcagctg
gaaactgatttgaagattgagaaggaatggaggcaaactttgcaggaagatcttcaaaag
gagaaagatgccttatctcatcttagaaatgagacccaacaaatggctagtcttaaaaaa
gagttccttagcctccaggatgaaaaccagcaattgaaaaaaatctgtcatgaacaagag
caagcgctccaagaactcggcaacaagctcagcgaatcaaaacttaagatagaagacata
aaagaagccaacaaagccttgcagggactggtttggctgaaagacaaagaagcaacacac
tgtaaactttgtgaaaaggaattctcactttcaaaaagaaagcaccactgtagaaactgt
ggggagattttctgtaatgcctgctctgacaacgagctgcctctgccttcttcaccaaag
ccagtccgggtctgtgactcctgtcacgcaatgcttattcagagatgctcatctaatgtg
ccataa

DBGET integrated database retrieval system