KEGG   Oryctolagus cuniculus (rabbit): 100341130
Entry
100341130         CDS       T03373                                 
Symbol
RGMA
Name
(RefSeq) repulsive guidance molecule family member a
  KO
K23096  repulsive guidance molecule A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100341130 (RGMA)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100341130 (RGMA)
SSDB
Motif
Pfam: RGM_N RGM_C KAAG1
Other DBs
NCBI-GeneID: 100341130
NCBI-ProteinID: XP_002721894
Ensembl: ENSOCUG00000000236
LinkDB
Position
Un
AA seq 438 aa
MQPLSSSSRERLVAAGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSD
FWSATSGSHAPATEDAPEFCAALRTYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCS
KDGPTSQPRVRTLPPGDSQERSDSPETCHYERGFHKHAAAPNYTHCGLFGDPHLRTFTDR
FQTCKVQGAWPLIDNAYLNVQVTNTPVLPGSAATATSKLTIIFKSFQECVEQKVYQAEMG
ELPAAFADGSRNGGDKHGASSLQIAEKVSGQHVEIQARYIGTTIVVRQVGRYLTFAVRMP
QEVVEAVEDRDSQGLYLCLRGCPLSQQIDVQAAGPAPATPEAFPYEAAAAKCKEKLPVED
LYYQACVFDLLTTGDVNFTLAAYYALEDVRMLHSHKDRLHLFGRTRELPGGAAPRLPRGP
WPLLAALGLLLPLLPELR
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcagccgctaagctcttcctccagggagaggctcgtggcagcaggccgagctggatgg
atgggcatggggagaggggcaggacgctcagccctgggattctggccgacgctcgccttc
ctgctctgcagcttcccggcagccacctccccatgcaagatcctcaagtgcaactctgac
ttctggagcgccacgtcgggcagccacgccccggccacggaagacgccccggagttctgc
gccgccctgcgcacctacgccctgtgcacgcggcgcacggcccgcacctgccgcggtgac
ctggcctaccactcggccgtccatggcatcgaggacctcatgagccagcacaactgctcc
aaggatggccccacctcccagccacgcgtgcgcacgctgcccccgggcgacagccaggag
cgctcggacagccccgagacctgccactacgagaggggcttccacaagcacgcggccgcc
cccaactacacgcactgcggcctcttcggggacccacacctcaggacgttcaccgaccgc
ttccagacctgcaaggtgcaaggcgcctggcccctcatcgacaacgcttacctgaacgtg
caggtcaccaacacgcccgtgctgcccggctccgcggccaccgccaccagcaagctcacc
atcatcttcaagagcttccaggagtgcgtggagcagaaggtgtaccaggccgagatgggc
gagctcccggccgccttcgccgacggctccaggaacggcggcgacaagcacggggccagc
agcctgcagatcgccgagaaggtgtcgggccagcacgtggagatccaggccaggtacatc
ggcaccaccatcgtggtgcgccaggtgggccgctacctgaccttcgcggtgcgcatgccg
caggaggtggtggaggcggtggaggaccgggacagccagggcctctacctgtgtctgcgc
ggctgccccctcagccagcagatcgacgtccaggccgccggccccgcccccgccaccccc
gaggccttcccgtacgaggcggccgcggccaagtgcaaggagaagctgcccgtggaggac
ctgtactaccaggcctgcgtgtttgacctgctgaccacaggcgacgtgaacttcacgctg
gccgcctactatgccctggaggacgtcaggatgctgcactcacacaaggacaggctgcac
ctgttcgggaggactcgggagctgcccggcggggccgccccgcggctgccccggggcccc
tggcctctcctggccgccctgggcctgctcctccctctgctgcctgagctccgttag

DBGET integrated database retrieval system