KEGG   Oryctolagus cuniculus (rabbit): 100341176
Entry
100341176         CDS       T03373                                 
Symbol
UBE2D4
Name
(RefSeq) ubiquitin conjugating enzyme E2 D4 (putative)
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100341176 (UBE2D4)
   04120 Ubiquitin mediated proteolysis
    100341176 (UBE2D4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341176 (UBE2D4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100341176 (UBE2D4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100341176 (UBE2D4)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100341176
NCBI-ProteinID: XP_008260028
Ensembl: ENSOCUG00000008900
LinkDB
Position
10:44614586..44626673
AA seq 146 aa
MPVGAARELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPTDSPYQGGLFFLTIHFPTDYP
FKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVP
EIAHTYKADREKYNRLAREWTQKYAL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcccgtgggggcagcccgggaactgaccgacctgcagagagatcctccggcccagtgc
tccgcgggacccgtgggggacgacctgttccactggcaggccaccatcatgggcccgacg
gacagtccctaccaaggagggcttttcttcctgaccatccacttccctacggactaccct
ttcaagcccccgaaggttgctttcacaaccaaaatctatcaccccaacatcaacagcaat
ggcagcatctgcctcgacatcctgcggtcacagtggtccccggcgctgaccgtgtccaaa
gttctcttgtccatctgctccttgctctgcgaccccaatcccgatgacccactggtgccg
gagatagcccacacctacaaggccgacagagagaagtacaacagactagcgagagagtgg
acacagaaatacgctctgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100344895
Entry
100344895         CDS       T03373                                 
Symbol
UBE2D2
Name
(RefSeq) ubiquitin conjugating enzyme E2 D2
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100344895 (UBE2D2)
   04120 Ubiquitin mediated proteolysis
    100344895 (UBE2D2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100344895 (UBE2D2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100344895 (UBE2D2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100344895 (UBE2D2)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100344895
NCBI-ProteinID: XP_008253328
Ensembl: ENSOCUG00000029448
LinkDB
Position
3:21748444..21802411
AA seq 147 aa
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDREKYNRIAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctctgaagagaatccacaaggaattgaatgacctggcccgggaccccccagcacag
tgttcagcaggtcctgttggagatgatatgttccattggcaggctacgataatggggcca
aatgacagtccctatcagggtggagtatttttcttgacaattcatttccctacagattac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcacccaaatattaacagt
aatggcagcatttgtcttgatattctacggtcacagtggtctccagcactaactatttca
aaagtcctcttgtccatctgttctctgttgtgtgatcccaatccagatgatcctttagtg
cctgagattgctcggatctacaaaacagatagagaaaagtacaacagaatagctcgggaa
tggactcagaagtatgcgatgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100347511
Entry
100347511         CDS       T03373                                 
Symbol
UBE2D3
Name
(RefSeq) ubiquitin conjugating enzyme E2 D3
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100347511 (UBE2D3)
   04120 Ubiquitin mediated proteolysis
    100347511 (UBE2D3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100347511 (UBE2D3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100347511 (UBE2D3)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100347511 (UBE2D3)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100347511
NCBI-ProteinID: XP_002717257
UniProt: A0A5F9C5R6
LinkDB
Position
15:46796784..46832054
AA seq 147 aa
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaaacggattaataaggaacttagtgatttggcccgtgaccctccagcacaa
tgttctgcaggtccagttggggatgatatgtttcactggcaagccacaattatgggacct
aatgacagcccatatcaaggcggtgtattctttttgacaattcattttcctacagactac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtctcgatattctaagatcacagtggtctcctgctttaactatttct
aaagttcttttatccatttgttcactgctatgtgatccaaacccagatgaccccctagtg
ccagagattgcacggatctataaaacagacagagataagtacaacagaatatctcgggaa
tggactcagaagtatgccatgtga

KEGG   Oryctolagus cuniculus (rabbit): 100355225
Entry
100355225         CDS       T03373                                 
Symbol
UBE2D1
Name
(RefSeq) ubiquitin conjugating enzyme E2 D1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100355225 (UBE2D1)
   04120 Ubiquitin mediated proteolysis
    100355225 (UBE2D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100355225 (UBE2D1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100355225 (UBE2D1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100355225 (UBE2D1)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100355225
NCBI-ProteinID: XP_002718528
UniProt: A0A5F9CFA6
LinkDB
Position
18:complement(27793777..27836717)
AA seq 147 aa
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRHAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaagcggattcagaaagaattaagtgatctacagcgtgatccaccggctcac
tgttccgctggccctgtgggagatgacttgttccactggcaagcaactattatggggcct
cccgatagtgcatatcaaggtggagtcttcttcctcaccgtacattttccaacagattat
ccttttaaaccaccaaagattgctttcacaacaaaaatttaccatccaaatataaacagt
aatggaagtatttgtctcgatatcctgaggtcgcagtggtcaccagccctgactgtatca
aaagttttattgtccatatgttctctactttgtgatcctaatccagatgaccctttagta
ccagatattgcacaaatatataaatcagacaaagaaaaatacaacagacatgcaagagaa
tggactcagaaatatgcaatgtaa

DBGET integrated database retrieval system