KEGG   Oryctolagus cuniculus (rabbit): 100341202
Entry
100341202         CDS       T03373                                 
Symbol
VPS26A
Name
(RefSeq) VPS26, retromer complex component A
  KO
K18466  vacuolar protein sorting-associated protein 26A/B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341202 (VPS26A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341202 (VPS26A)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    100341202 (VPS26A)
SSDB
Motif
Pfam: Vps26 Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 100341202
NCBI-ProteinID: XP_017204222
Ensembl: ENSOCUG00000001513
LinkDB
Position
18:complement(17610625..17644710)
AA seq 360 aa
MSEPLPAFLGRLRGPWLGTRSPPVQGLAAASPSKSFLGGFFGPICEIDVVLNDGETRKMA
EMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNTHE
FVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEY
DLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHM
ELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKK
FSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESSESQASAEQPEM
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcggagcctctgcccgcgttcctcggccgactgcggggcccctggctgggcacccgg
agcccgcctgtgcaggggctcgccgccgcctccccgtccaagagttttcttggaggcttt
tttggtcccatttgtgagatcgacgttgtccttaatgatggggaaaccaggaaaatggca
gaaatgaaaactgaagatggcaaagtagaaaaacactatctcttctatgatggagaatct
gtctcaggaaaggtaaacctagcctttaagcaacctggaaagaggctagagcaccaagga
attagaattgaatttgtaggtcaaattgaacttttcaatgacaagagtaatactcatgaa
tttgtaaacctagtgaaagaactggccttacccggagaactgactcagagcagaagttat
gattttgaatttatgcaagttgaaaagccatatgaatcttacatcggtgccaatgttcgc
ttgaggtattttcttaaggtgacaatagtaagaagactgacagacttggtaaaagagtat
gatcttattgttcaccagcttgccacctatcctgatgttaacaactctattaagatggaa
gtgggcattgaagattgtctgcatatagaatttgaatataataaatcaaagtatcattta
aaggatgtgattgttggaaaaatttacttcttattagtaagaataaaaatacaacatatg
gagttacaacttattaaaaaagagatcacaggaattggacccagcaccacaacagaaaca
gaaacaatcgccaaatatgaaataatggatggtgcacctgtaaaaggtgaatccattcca
ataagactatttttagcaggatatgaccctaccccaacaatgagagatgtgaacaagaag
ttttccgtgaggtacttcctgaatcttgtgcttgtggatgaggaagacagacggtacttc
aagcagcaggagatcattttatggagaaaagctcctgaaaaactgaggaaacaaagaaca
aactttcaccagcggtttgaatcttcagagtcacaggcatctgctgagcagcccgaaatg
tga

KEGG   Oryctolagus cuniculus (rabbit): 100347278
Entry
100347278         CDS       T03373                                 
Symbol
VPS26B
Name
(RefSeq) VPS26, retromer complex component B
  KO
K18466  vacuolar protein sorting-associated protein 26A/B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347278 (VPS26B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347278 (VPS26B)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    100347278 (VPS26B)
SSDB
Motif
Pfam: Vps26 Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 100347278
NCBI-ProteinID: XP_002721603
LinkDB
Position
Un
AA seq 336 aa
MSFFGFGQSVEVDILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLALKNPNKR
LEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYT
GQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTTSLGEVRTPGQLSDNNSRQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgagcttcttcggcttcgggcagagcgtggaggtggacatcctgctgaacgatgcggag
agtcgcaagcgcgccgagcacaagacggaggatgggaagaaggagaaatatttcctcttc
tacgacggcgagaccgtctccggcaaggtgagcctcgcgctcaagaaccccaacaagcgg
ctggagcaccagggcatcaagatcgagttcatcgggcagatcgaactctactacgaccgc
gggaaccaccatgagtttgtgtccctggtgaaggacctggctcggcccggagaaatcacg
cagtcacaggcctttgactttgagttcacccatgtggagaagccgtatgagtcatataca
gggcagaatgtgaagctgcgctatttccttcgagccaccattagccgccgcctcaacgat
gttgtcaaagagatggacatcgtggttcacacgctcagcacatacccggagctgaactca
tccatcaagatggaggttggcatcgaggactgcctgcacattgagtttgagtataataaa
tccaaataccacttgaaagatgtcatcgtagggaagatatacttcctgctggtgagaatc
aaaatcaagcacatggagatagacatcatcaagcgggagacaacaggcaccggccccaac
gtgtaccacgagaatgacacgatagccaagtatgagataatggacggggcgccggtgcga
ggagagtccatcccgatccggctcttcctagcagggtacgagctcacgcccaccatgcgg
gacatcaacaagaagttctctgtgcgctattacctcaacctggtgctgatagacgaggag
gaacggcgctacttcaagcagcaggaagtggtgttgtggcggaagggtgacatcgttcgc
aagagcatgtcccaccaggcagccattgcctcacagcgcttcgagggcacaacctcccta
ggtgaggtgcggaccccaggccagctgtccgacaacaacagcagacagtag

DBGET integrated database retrieval system