KEGG   Oryctolagus cuniculus (rabbit): 100341360
Entry
100341360         CDS       T03373                                 
Symbol
BMP8A
Name
(RefSeq) bone morphogenetic protein 8B
  KO
K16622  bone morphogenetic protein 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100341360 (BMP8A)
   04390 Hippo signaling pathway
    100341360 (BMP8A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341360 (BMP8A)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100341360 (BMP8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341360 (BMP8A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100341360 (BMP8A)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100341360
NCBI-ProteinID: XP_008263746
LinkDB
Position
13:complement(126972919..127003781)
AA seq 768 aa
MRKGGSGVLGQGPRAPWPGGRWVRVSSAAGSAWGPQGAQQGTAGSARSRHFQRARGSQGV
GARGAAPEQVWAQEEHVAAQSGDAGRHGKVAGAVEPTHRLRVWRNAPILGTAPAAPTCRL
RSLSPGSRLPARRGGAAGSHRGSDRDWTPAWARSPCGSSGPSLPGPRRAPEVSRPSPREG
PDGVDRARSRRKGPRTTLTMSACPKPPRGRTLESPPPATSGSTRTLPGRGFGALTPPPGP
HWPDRAGARPGWCGLQGLAEAGAGPRRPIARSSCAAAARGGSADGAGLGNSSSSQAAAAA
AAASTGPQAETGAAGVPWGPSRRRGRQLPGPASRRAQPTARRPGGPGLLSQPRSRCASAE
RPARPAMAARPGPLWLLGLALCALGGGPGPRPPPGCPQRRLGARERRDMQREILAVLGLP
GRPRPRAPPAASRLPASAPLFMLDLYRAMASDDDDDDAGPPERRLGRADLVMSFVNMVER
DHALGRQEPHWKEFLFDLTQIPAGEAVTAAEFRIYKEPSTQLVNRTLHVSTFQVVQEHSN
RESDLFFLDLQTLQAGDEGWLVLDVTAAGDRWLLSRHKDLGLRLYVETEDGLSVIRAGPG
LLGQRAPRSRRPIHGHFFRASPSPGRAPRALRPLKRRQPKRTNELPQPNKLPGIFDAVHG
SNGRQVCRRHELYVSFRDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLV
HLMKPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgcgcaaaggtggctccggggtgctcgggcagggccccagagctccttggcccggcggg
aggtgggtgcgtgtttccagcgcagcgggatcagcctggggcccgcagggcgcacagcaa
gggacggcggggtcggcccgctccaggcacttccagagagcacgcgggagccagggggtg
ggcgcgcggggagcggcccctgagcaggtgtgggctcaggaggagcacgtagcagcgcag
tcaggtgacgcaggccggcacgggaaggtggctggagctgtggaaccgacacacaggctg
cgcgtgtggaggaatgcgcccatcctcgggacagcaccggccgcccctacctgcagactg
aggtcgctgtctcctggaagccgactccctgcgcgccgaggcggggccgccgggtcacac
cgcggatctgaccgggattggacgccggcctgggcgaggtcgccctgcgggagctcaggt
cccagccttccgggcccgcgccgcgcccctgaggtctcccggccgagcccccgcgagggg
cctgacggcgtggacagggctaggagcaggaggaagggtcccaggacgaccctgaccatg
tccgcctgtccgaaaccacctcggggtcgcactttagagtcaccaccaccggcgacatca
ggctccacccggacccttcccggacgtgggttcggagccttgaccccacccccgggcccc
cattggcccgaccgggcgggggcgaggccggggtggtgcgggctacagggtctggctgag
gccggtgcaggtccgcgccgcccgattgcccggagctcttgcgccgcagcagcccggggc
ggatcagccgacggtgcgggtctcgggaatagctccagttcccaggcggcggcggcggcg
gcggccgcgtccacagggccccaagcagagacaggtgccgcgggagtgccctggggccct
agccgtcgccgcggacggcaactgcccggtcccgccagccgtcgagcccagcccaccgct
cgccgtccgggcggtcccgggctcctgtcccagccgcggagccgatgcgcgtccgctgag
cgcccagcccggcccgccatggccgcgcgccccgggccgctctggctcctgggcctggct
ctgtgcgcgctgggcggcggccccggcccgcgccccccgcccggctgtccccagcgtcgc
ctgggagcgcgcgagcgccgcgacatgcagcgcgagatcctggcggtgctcgggctgccc
gggcggccccggccccgcgcgccacccgccgcctcccgcctgcccgcgtccgcgccgctc
ttcatgctggacctgtaccgcgccatggccagcgacgacgacgacgacgacgccgggccc
cctgagcggcgcctgggccgcgcagacctggtcatgagcttcgtcaacatggtggagcgt
gaccacgccctgggccgccaggagccccactggaaggagtttctcttcgacctgactcag
atcccagcgggggaggcggtgacagctgccgagttccggatctacaaggagcccagcacg
cagctggtcaacaggaccctgcacgtcagcacgttccaggtggtccaggagcactccaac
agggagtctgacttgttctttttggatcttcagacgctccaggctggggacgagggctgg
ctggtgctggacgtcacggcagccggtgaccgctggctgttgagccgtcacaaggacctg
ggactccgcctctatgtggagacggaggacgggctcagcgtgatccgggccgggcccggg
ctgctggggcagcgggccccgcgctcccgccggccaattcatggtcacttcttcagggcc
agcccgagccctggacgcgcccctcgggccctgaggccgctgaagaggaggcagccgaag
agaaccaacgagctgccgcagcccaacaagctgccggggatcttcgatgctgtccacggc
tccaacggccggcaggtgtgccgtcggcacgagctctacgtcagcttccgggacctcggc
tggctggactgggtcatcgccccccaaggctactcggcctattactgtgagggcgagtgc
tccttcccgctggactcctgcatgaatgccaccaaccatgccatcctgcagtccctggtg
cacctgatgaagccagacgcggtccccaaggcgtgctgcgcgcccaccaagctgagcgcc
acctccgtgctctactacgacagcagcaacaacgtgatcctgcgcaagcaccgcaacatg
gtggtcaaggcctgcggctgccactga

KEGG   Oryctolagus cuniculus (rabbit): 103350213
Entry
103350213         CDS       T03373                                 
Symbol
BMP8B
Name
(RefSeq) bone morphogenetic protein 8A
  KO
K16622  bone morphogenetic protein 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103350213 (BMP8B)
   04390 Hippo signaling pathway
    103350213 (BMP8B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103350213 (BMP8B)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103350213 (BMP8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103350213 (BMP8B)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103350213 (BMP8B)
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 103350213
NCBI-ProteinID: XP_008263737
LinkDB
Position
13:126720538..126739763
AA seq 459 aa
MRTPGSACPKPPRGRTLESPPPATPGSTRTLPGRGFGALTPPPGPHWPDRAGARPGWCGR
QGLAEAGAGPRRRIAPSSRAAAARGGLADGAGLGNSSSSEAAAAAASTGPQAETGASGVP
WGPSCRRGRQLPGPAGRRAQPTARRPGGPGLRSQPRSRCASAERPARPAMAARPGPLWLL
GLALCALGGGPGPRPPPGCPQRRLGARERRDMQREILAVLGLPGRPRPRAPPAASRLPAS
APLFMLDLYRAMAGDDDDDDAGPPERRLGRADLVMSFVNMVERDHALGRQEPHWKEFLFD
LTQIPAGEAVTAAEFRIYKEPSTQLVNRTLHVSTFQVVQEHSNRESDLFFLDLQTLQAGD
EGWLVLDVTAASDRWLLSRHRDLGLRLYVETEDGEARGWAPGSGLLRAVPAGASGTQRLL
SCALRDASEVHGEVPAGGPGVGWPPTPDRQDLGLEGWGE
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcggactcctggctccgcctgtccgaaaccacctcggggtcgcactttagagtcacca
ccaccggcgacaccaggctccacccggacccttcccggacgtgggttcggagccttgacc
ccacccccgggcccccattggcccgaccgggcgggggcgaggccggggtggtgcgggcga
cagggtctggctgaggccggtgcaggtccgcgccgccggatcgccccgagctctcgcgcc
gcagcagcccggggcggattagccgacggtgcgggtctcgggaatagctccagttccgag
gcggcggcggcggccgcgtccacagggccccaagcagagacaggtgcctcgggagtgccc
tggggccctagctgtcgccgcggacgacaactgcccggtcccgccggccgtcgagcccag
cccaccgctcgccgtccgggcggtcccgggctccggtcccagccgcggagccgatgcgcg
tccgctgagcgcccagcccggcccgccatggccgcgcgccccgggccgctctggctcctg
ggcctggctctgtgcgcgctgggcggcggccccggcccgcgccccccgcccggctgtccc
cagcgtcgcctgggagcgcgcgagcgccgcgacatgcagcgcgagatcctggcggtgctc
gggctgcccgggcggccccggccccgcgcgccacccgccgcctcccgcctgcccgcgtcc
gcgccgctcttcatgctggacctgtaccgcgccatggccggcgacgacgacgacgacgac
gccgggccccctgagcggcgcctgggccgcgcagacctggtcatgagcttcgtcaacatg
gtggagcgcgaccacgccctgggccgccaggagccccactggaaggagtttctcttcgac
ctgactcagatcccagcgggggaggcggtgacagctgccgagttccggatctacaaggag
cccagcacgcagctggtcaacaggaccctgcacgtcagcacgttccaggtggtccaggag
cactccaacagggagtctgacttgttctttttggatcttcagacgctccaggctggggac
gagggctggctggtgctggacgtcacggcagccagtgaccgctggctgttgagccgtcac
agggacctgggactccgcctctatgtggagacggaggacggtgaggctaggggctgggct
ccgggctccgggctcctcagagctgtcccagcaggggcttctggcacgcagcgccttctc
agctgtgccctcagggatgccagtgaggtccacggtgaggtcccagcaggaggccctggc
gtgggctggccccccactcctgaccggcaggatctgggcctggaagggtggggggagtga

DBGET integrated database retrieval system