KEGG   Oryctolagus cuniculus (rabbit): 100341589
Entry
100341589         CDS       T03373                                 
Symbol
CFL1
Name
(RefSeq) cofilin 1
  KO
K05765  cofilin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05133  Pertussis
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100341589 (CFL1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100341589 (CFL1)
  09158 Development and regeneration
   04360 Axon guidance
    100341589 (CFL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341589 (CFL1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100341589 (CFL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341589 (CFL1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100341589 (CFL1)
   04147 Exosome [BR:ocu04147]
    100341589 (CFL1)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Others
    100341589 (CFL1)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     100341589 (CFL1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100341589 (CFL1)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 100341589
NCBI-ProteinID: XP_002724041
Ensembl: ENSOCUG00000025604
LinkDB
Position
Un
AA seq 166 aa
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIVLEEGKEILVGDV
GQTVEDPYATFVQMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcctccggcgtggctgtctctgacggcgtcatcaaggtgttcaacgacatgaaggtg
cgcaagtcgtcgacgcccgaggaggtgaagaagcgcaagaaggcggtgctgttctgcctg
agcgaggacaagaagaacatcgtgctggaggagggcaaggagatcctggtgggcgacgtg
ggccagaccgtggaggacccctacgccaccttcgtgcagatgctgcccgacaaggactgc
cgctacgccctctacgacgccacctacgagaccaaggagagcaagaaggaggacctggtg
ttcatcttctgggcccccgagtgtgcgcccctcaagagcaaaatgatctacgccagctcc
aaggacgccatcaagaagaagctgacaggaatcaagcatgaattgcaagccaactgctac
gaggaggtgaaggaccgctgcaccctggcggagaagctggggggcagcgccgtcatctcc
ctggagggcaagcccttgtga

KEGG   Oryctolagus cuniculus (rabbit): 100359205
Entry
100359205         CDS       T03373                                 
Name
(RefSeq) cofilin-2
  KO
K05765  cofilin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05133  Pertussis
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100359205
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100359205
  09158 Development and regeneration
   04360 Axon guidance
    100359205
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100359205
  09171 Infectious disease: bacterial
   05133 Pertussis
    100359205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100359205
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100359205
   04147 Exosome [BR:ocu04147]
    100359205
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Others
    100359205
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     100359205
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100359205
SSDB
Motif
Pfam: Cofilin_ADF Ribosomal_S2
Other DBs
NCBI-GeneID: 100359205
NCBI-ProteinID: XP_017198763
LinkDB
Position
8:6974090..6975420
AA seq 166 aa
MASGVTVNDEVIKVFNDMKVKKCSTQEEIXKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSSVKLLPLNDXRYALYDATYETEESKKEDLVFISWGPESAPLKSSMIYASS
KDAIKKKFTGIKHEWQVSGLDDIKDRSTLGEKLGGSAVVSLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta
aagaaatgttctacacaagaggagatcnaaaaaagaaagaaagcagttctcttctgttta
agtgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt
ggtgatactgtagaggacccctacacatcttctgtgaagttgctacctctgaatgatntc
cgatatgctttgtacgatgccacatatgaaacagaagagtctaagaaagaagacctagtg
tttatatcctggggtcctgaaagtgcacctttgaaaagcagtatgatttatgctagctct
aaagatgccattaaaaagaaatttacagggattaaacacgaatggcaagtgagtggcttg
gatgacatcaaggaccgttcaacacttggagagaaattgggaggcagtgcagtagtttca
cttgaaggaaaaccactataa

KEGG   Oryctolagus cuniculus (rabbit): 108178303
Entry
108178303         CDS       T03373                                 
Symbol
CFL2
Name
(RefSeq) cofilin 2
  KO
K05765  cofilin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05133  Pertussis
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108178303 (CFL2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    108178303 (CFL2)
  09158 Development and regeneration
   04360 Axon guidance
    108178303 (CFL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108178303 (CFL2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108178303 (CFL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    108178303 (CFL2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    108178303 (CFL2)
   04147 Exosome [BR:ocu04147]
    108178303 (CFL2)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Others
    108178303 (CFL2)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     108178303 (CFL2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   108178303 (CFL2)
SSDB
Motif
Pfam: Cofilin_ADF Ribosomal_S2
Other DBs
NCBI-GeneID: 108178303
NCBI-ProteinID: XP_017203747
LinkDB
Position
17:complement(54492756..54495021)
AA seq 166 aa
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta
aggaaatcttctacacaagaggagatcaaaaaaagaaagaaagcagttctcttctgttta
agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt
ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc
cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta
tttatattctgggctcctgaaagtgcacctttaaaaagcaagatgatttatgctagctct
aaagatgccattaaaaagaaatttacagggattaaacacgaatggcaagtgaatggcttg
gatgacattaaggaccgttcaacacttggagagaagctgggaggcaatgtagtagtttca
cttgaaggaaaaccactataa

DBGET integrated database retrieval system