KEGG   Oryctolagus cuniculus (rabbit): 100341605
Entry
100341605         CDS       T03373                                 
Symbol
IRAK4
Name
(RefSeq) interleukin 1 receptor associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100341605 (IRAK4)
   04064 NF-kappa B signaling pathway
    100341605 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100341605 (IRAK4)
   04621 NOD-like receptor signaling pathway
    100341605 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100341605 (IRAK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341605 (IRAK4)
   05161 Hepatitis B
    100341605 (IRAK4)
   05171 Coronavirus disease - COVID-19
    100341605 (IRAK4)
   05164 Influenza A
    100341605 (IRAK4)
   05162 Measles
    100341605 (IRAK4)
   05168 Herpes simplex virus 1 infection
    100341605 (IRAK4)
   05169 Epstein-Barr virus infection
    100341605 (IRAK4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100341605 (IRAK4)
   05135 Yersinia infection
    100341605 (IRAK4)
   05133 Pertussis
    100341605 (IRAK4)
   05152 Tuberculosis
    100341605 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341605 (IRAK4)
   05140 Leishmaniasis
    100341605 (IRAK4)
   05142 Chagas disease
    100341605 (IRAK4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100341605 (IRAK4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100341605 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100341605 (IRAK4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100341605 (IRAK4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100341605 (IRAK4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Death Haspin_kinase
Other DBs
NCBI-GeneID: 100341605
NCBI-ProteinID: XP_002712673
Ensembl: ENSOCUG00000004103
UniProt: G1SL29
LinkDB
Position
8:complement(2529186..2551770)
AA seq 460 aa
MNKPISPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAAAIKKPSGDDRYNQLHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDALPKTVNTLPAKEAITA
QQKLIPFHDKGKTSVIPVQNLEKNCVLPDSSSPENKSLGVSDTRFHSFSFYELRSITNDF
DERPIARGGNKMGEGGFGVVYKGCLRNTPVAVKKLAAMVDISTEELKQQFEQEIKVMAKC
QHENLVQLLGFSKDGDDLCLVYVYMPNGSLLDRLLCLDDTAPLSWHTRCNIAQGAAAGIS
FLHENHHIHRDIKSANILLDKAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYVDTKMSD
AEPSSVESMYSVACQCLHEKKNKRPDIKKVQQLLQEMIPS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacaaacccatatcaccatcaacgtatgtgcgctgcctcaatgttggattgattcgg
aagctgtcagattttattgatcctcaggaaggatggaagaaattagccgcagctattaag
aaaccatctggggatgacagatacaatcaattacacatcaggagatttgaagcattactt
caaactggaaaaagtcccacgtgcgaattactgtttgattggggcacgacgaattgcaca
gttggtgatcttgtggatcttttgatccaaaatgagtttttcgctcctgcaagtcttttg
ctaccagacgctctccccaaaactgtcaacacattacctgctaaggaggctataacagct
cagcagaaactgattccttttcatgacaaaggcaagacatcagtgatacctgtacagaat
cttgaaaaaaactgtgtacttcctgactcctcaagtccagaaaataaaagtctaggagtt
agtgatacacgttttcacagcttctccttttatgaattgaggagcatcactaatgacttt
gacgaacgacccattgctcgtggtggtaacaagatgggtgaggggggctttggcgtggtg
tacaaaggctgcctgcgcaacactcccgtggcagtgaagaagctcgcagcaatggttgat
attagtactgaagaactgaaacaacagtttgaacaagaaataaaagtaatggcaaagtgc
cagcatgaaaacttggtacaactgcttggtttctcaaaggatggagatgatctctgcctc
gtgtatgtctacatgcccaatggctcattgctggacagattgttatgcctggatgataca
gcaccactttcatggcacacaagatgcaacatcgctcagggtgctgcagctggcatcagc
tttttacacgaaaatcatcatattcatagagatattaaaagtgcaaatatcttactagac
aaagccttcactgccaaaatctctgactttgggcttgcacgtgcatctgagaagtttgcc
cagacagtgatgaccagcagaattgtgggaacaacagcttacatggcgcctgaagctttg
cgaggagaaataacacccaaatctgacatctacagctttggagtggtgttactggaaata
ataactggacttccagctgtggatgaacaccgtgaacctcagttactactagacattaaa
gaagaaattgaagatgaagaaaagacaattgaagattatgtggatacgaagatgagtgat
gctgagccctcttcagttgaaagtatgtactctgttgcttgtcagtgtctgcatgaaaag
aaaaataagagaccagatattaagaaggttcaacagttgctgcaagagatgataccttcc
taa

DBGET integrated database retrieval system