KEGG   Oryctolagus cuniculus (rabbit): 100341848
Entry
100341848         CDS       T03373                                 
Symbol
IL17B
Name
(RefSeq) interleukin 17B
  KO
K05490  interleukin 17B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341848 (IL17B)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100341848 (IL17B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341848 (IL17B)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100341848 (IL17B)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100341848
NCBI-ProteinID: XP_002710347
Ensembl: ENSOCUG00000016145
UniProt: G1TAZ7
LinkDB
Position
3:complement(31217262..31223281)
AA seq 175 aa
MDWPHSLVFLLTISIFLGLGQPRNPKGKRKGPWRPGPQQVPQDLVSRAKPFARMEEYERN
LGEMVAQLRNSSEPAKRKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEAQCLCLG
CVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
NT seq 528 nt   +upstreamnt  +downstreamnt
atggactggccgcacagcctggtgttccttcttaccatctccatcttcctggggctgggc
cagcccaggaaccccaaaggcaagaggaaggggccctggcggcctgggcctcagcaggtg
ccacaggacctggtgtcgcgggcaaagccattcgcccgtatggaggagtacgagaggaac
cttggggagatggtggcccagctgcgaaacagctctgagccggccaagaggaagtgtgag
gtcaacctgcagctgtggctgtccaacaagaggagtctatctccctggggctacagcatc
aaccacgaccccagtcgcattcccgcagacctgccggaggcccagtgcctgtgtctgggc
tgcgtgaaccccttcaccatgcaggaggaccgcagcatggtgagtgtgcccgtgttcagc
caggttcccgtgcgtcgccgcctctgcccaccgccgccacgcaccgggccctgccgccag
cgcgccgtcatggagaccatcgccgtgggctgcacctgcatcttctga

DBGET integrated database retrieval system