KEGG   Oryctolagus cuniculus (rabbit): 100342051
Entry
100342051         CDS       T03373                                 
Symbol
SEMA4A
Name
(RefSeq) semaphorin 4A
  KO
K06521  semaphorin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100342051 (SEMA4A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100342051 (SEMA4A)
CD molecules [BR:ocu04090]
 Proteins
  100342051 (SEMA4A)
SSDB
Motif
Pfam: Sema PSI PSI_integrin
Other DBs
NCBI-GeneID: 100342051
NCBI-ProteinID: XP_008262543
Ensembl: ENSOCUG00000001326
LinkDB
Position
13:complement(36693520..36714812)
AA seq 765 aa
MALPAPGPAPCSLLGLFLFQLLLSTTTTMTTAGSGGQGPIPRVKYQAGDRRRALGFFHQK
GLQDFDTLLLSGDGGTLYVGAREAILALNIQDPEVPRLKNMIHWPASDGKKSECARKTPN
REVVETQCFNFIRVLVSLNDTHLYACGTFAFSPACTFLELQDSFLLPISEDKVVEGKGQS
PFSPAHKHTAVLVDGTLYSGTMNNFLGNQPVLMRTLGSQPVLKTDTFLCWLHSDASFVAA
IPSTQVVYFFFEETASEFDFFEKLHTSRVAQVCKNDVGGEKLLQKKWTTFLKAQLLCAQP
GQLPFNIIRHAVLLPADPPAAARVLAVFTSQWQVGGTKSSAVCAFSLRDIEWVFKGTYKE
LNKETSRWTTYRGPSITPRPGSCSVGPSSDKALTFIKDHYLMDGQVVGVPLLVKSGVEYT
QLAVETAQDLEGRSHLVLYLGTATGALHKAVVSEDSSAHLVEEIQLFPRQEPVRNLQLVP
AQDAVFVGSSAGVWRVPRANCSVYESCVDCILARDPHCAWHLESQMCRFLSAPSLNTWKQ
DMKRGNPGWACTNGPMGRSHRPQSRPQIIKEVLAVPNSILELPCPRLSALASYHWSHGAA
TIQETPSTVYNGSLLLMPRDGVGGLYQCMATENGFSYPVVSYWVDSQDQPLALDPELTGI
PRERVQVPLTRVSGRAALADQRSYWPHFLVVTILLALVLSGALIVLLASPLGALRARGKV
QGCEMLPPREKAPLSREQHLQPPKEQRTSASDVDADNNHLGPEVA
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggccctcccggccccgggcccggccccctgcagcctcctgggccttttcctcttccaa
ctgctcctgtccacgacgacgacaatgacgacggcggggagtggcggccaggggcccatt
cccagggtcaagtaccaggcaggggacagacgcagggcgcttggcttcttccaccaaaag
ggcctccaggattttgacactctgcttttgagtggagatggaggcactctgtacgtcggg
gcccgagaggccattctggccttgaatatccaggacccagaagtcccaaggctgaagaac
atgattcactggccagccagcgacgggaagaagagtgagtgcgcccgtaagacgcccaac
agggaggtagtcgagacacagtgtttcaacttcatccgcgtcctggtctctttgaatgat
acccacctctatgcctgcggcaccttcgccttcagccccgcctgcaccttccttgaactc
caagactccttcctgctgcccatctctgaggacaaggtcgtggaggggaaaggccagagc
cccttcagccccgcccacaagcacaccgctgttttggtggatggcacgctctattcgggc
accatgaacaacttcctgggcaatcagcctgtcctgatgcgcaccctgggatcccagccg
gtcctcaagacagacaccttcctctgctggctgcactcggatgcctccttcgtggctgcc
atcccgtccactcaggtcgtctacttcttcttcgaggagacagccagtgagtttgacttc
ttcgagaagctgcacacctcccgggtggctcaagtctgcaagaacgacgtcggcggcgaa
aaactgcttcagaagaagtggaccaccttcctgaaggcccagctgttgtgcgcccagccc
gggcagctgcccttcaacatcatccgccacgcggtcctgctgcccgccgaccctcccgcc
gcagcccgcgtcctcgcagttttcacctcccagtggcaggtcggtgggaccaagagttct
gcagtttgtgccttctcgctcagggacattgagtgggtcttcaagggaacgtacaaggag
ttgaacaaagaaacttcacgctggactacgtaccggggcccttccatcaccccccggcca
ggcagctgctctgtgggcccctcctccgataaagccttgaccttcatcaaggaccactat
ctgatggatggacaagtggtgggcgtgcccctgctggtgaagtccggtgtggagtacaca
cagctggcagtggagacggcccaggatctggaggggcgcagccatctggtcctgtacctg
ggcaccgccacgggcgccctgcacaaggccgtggtgagtgaggacagcagcgcccacctg
gtggaggagatccagttgttccctcgccaggaacctgttcgcaacctgcagctggtcccc
gcccaggacgcagtgttcgtgggctcctcagcaggcgtctggagggttccccgtgccaac
tgcagtgtctacgagagctgcgtggactgtatcctggccagggacccgcattgcgcctgg
cacctcgagtcccaaatgtgccgcttcctgtccgccccgagcctgaacacctggaagcag
gacatgaagcgagggaacccagggtgggcctgcaccaatggccccatgggcaggagccac
cggccccagagccgcccacagatcattaaggaagtcctggccgtccccaactccatcctg
gagctcccctgcccccgcctgtcagccctggcctcttaccactggagtcacggcgcagcc
accatccaggagaccccctccacagtctacaacggctccctcctgctgatgccccgggat
ggagttggaggcctttaccagtgcatggccactgagaacggcttctcataccctgtggtc
tcctactgggtggacagccaagaccagcccctggcgctggaccctgaactcaccggcatt
ccccgggagcgtgtgcaggtgccgctgaccagggtcagcggcagggccgcgctggctgac
cagcggtcctactggccccactttctcgtcgtcaccatcctccttgccttggtgctgtct
ggagccctcattgtcctcctcgcctccccgctgggggcgcttcgggctcggggcaaagtc
caaggctgtgagatgctgccccccagggagaaggcccccctgagcagggaacagcacctg
cagccccccaaggaacaaaggacctctgccagtgacgtggacgctgacaacaatcacctg
ggtcccgaggtggcttaa

KEGG   Oryctolagus cuniculus (rabbit): 100345573
Entry
100345573         CDS       T03373                                 
Symbol
SEMA4C
Name
(RefSeq) semaphorin 4C
  KO
K06521  semaphorin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100345573 (SEMA4C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100345573 (SEMA4C)
CD molecules [BR:ocu04090]
 Proteins
  100345573 (SEMA4C)
SSDB
Motif
Pfam: Sema PSI Ig_3 Ig_2 Sema4F_C I-set ig Paramecium_SA LapA_dom PSI_integrin
Other DBs
NCBI-GeneID: 100345573
NCBI-ProteinID: XP_008251910
Ensembl: ENSOCUG00000003347
LinkDB
Position
2:94616692..94624183
AA seq 836 aa
MAPHWAVWLLAAGLWGLGIGAEVWWNLVPRKTVPSGELATVVRRFSQTGIQDFLTLTLTE
QTGLLYVGAREVLFAFSVEALELQGVISWEAPAEKKVECSQKGKSNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYIDMLTFTLERREPEDGKGKCPYDPTKGHTGLLVDGELYSAT
LNNFLGTEPVILRNMGPHHTMKTEYLASWLNEPHFVGSAYIPESVGSFTGDDDKIYFFFR
ERAVEYDCYAEQVVARVARICKSDLGGARTLQRKWTTFVKARLVCSAPDWQLYFNQLQAT
HTLQGASWHNTTFFGVFRARWGDMDLSAICEYQLADIHQVFEGPYKEYREEAQKWGRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNTLNFIKKHPLMEEQVRPRWGRPLLVKKNTNF
THVVADRVAGLDGATYIVLFIGTGDGWLLKAVSLGPWVHMIEELQVFDQEPVESLVLSQS
KKLLFAGSRSQLVQVPLADCAKYRSCADCVLARDPFCAWNANTSRCVPPGXREGPGGSLL
LQQMNTSDTSGVCNQRGGKKVRLTPKNITVVAGTDLVLPCRLSSNLAHAHWTFRGRDLPA
EQPGFFLSDARLQALVVMAAQPHHSGTYRCFSEEQGARLAAESYLVDVMAGPSVTMEARA
PLENLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKAAERTLVYPLELPKEPTG
APFRPGPETDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGMPGQPLPSPTRLH
LGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggccccgcactgggccgtctggctgctggcagcagggctgtggggcctgggcattggg
gctgaggtgtggtggaacctcgtgccccggaagacagtaccttctggggagctggccacg
gtagtgcggcgcttctcgcagacgggcatccaggacttcctgacactgaccctgaccgag
cagaccgggctcctgtacgtgggggcccgtgaggtcctatttgccttcagcgtggaggct
ctggagctacaaggagtgatctcctgggaggccccggctgagaagaaggttgagtgttcc
cagaaaggaaagagcaatcagacggagtgcttcaacttcatccgcttcctgcagccctac
aacgcgtcccacctgtatgtgtgcggtacctacgccttccagcccaagtgcacgtacatc
gacatgctcaccttcactctggagcgcagagagccggaggacggcaaggggaagtgtcct
tacgacccaaccaagggccacactggcctcttagtggatggggagctctactcggccacc
ctcaacaacttcctgggcacggagcctgttatcctgcgtaacatggggcctcaccacacc
atgaagaccgagtacctggcctcctggctcaacgagcctcactttgtaggctccgcctac
atccctgagagcgtggggagcttcacgggggacgatgacaagatctacttcttcttcaga
gagcgggccgtggagtacgactgctatgctgagcaggtggtggctcgagtggcccgcatc
tgcaagagcgacctggggggagcgcggaccctgcagaggaagtggacgacgttcgtgaag
gcgcggctggtgtgctctgcgcccgactggcagctctactttaaccagctgcaggccacg
cacaccctacagggcgcctcctggcacaacaccaccttctttggggtttttagggcacga
tggggcgacatggacctgtcggcaatctgcgagtaccagctggcagacatccaccaggtg
tttgagggcccctacaaggagtaccgggaggaagcccagaagtggggccgctataccgac
ccggtccccagcccccggcccggctcgtgcatcaataattggcaccgacgccatggctac
accagttctctggagctgcctgacaataccctcaacttcatcaagaagcacccgctgatg
gaggagcaggtgcgccctcgctggggccggcccctgttggtgaagaagaacaccaacttc
acgcacgtggtggccgaccgggtcgcggggctggatggagccacctatatagtgctgttc
attggcacaggagacggctggctgctcaaggccgtgagcctggggccctgggtccacatg
atcgaggagctgcaggtgtttgaccaagagccggtggagagcctggtgctgtcccagagc
aagaagctcctcttcgctgggtcccgctcccagctggttcaggtgcccctggcagactgc
gccaagtaccgctcctgtgcagactgtgtccttgcccgggaccccttctgtgcctggaac
gccaacaccagccgctgcgtgcctccggggtgaagggaggggccaggaggatccctgctg
ttgcagcagatgaacacctcggacacctcaggcgtctgtaaccagcggggcggtaagaaa
gtcaggctcactcccaagaacatcaccgtggtggcgggcacagacctggtgctgccctgc
cgcctctcctccaacctggctcacgcccactggaccttcaggggccgggacctgcccgcc
gaacagcccggcttcttcctctcggatgcccgactccaggccctggtggtgatggctgcc
cagccccaccactccggcacctaccgctgcttttcagaggagcagggggcgcggctggct
gctgaaagctaccttgtggatgtcatggcgggaccctcagtgaccatggaggcccgggcc
cccttggagaacctggggctggtgtggctggccgtggtggccctgggagctgtgtgtctg
gtgctcctgctcctcgttttgtcactgcgccggcggctgcgggaagagctggagaaaggt
gccaaggccgccgagaggaccctggtgtaccctctggagctgcccaaggagcccactggc
gcccccttccggcctggccctgaaaccgacgagaaactttgggatccggttggctattac
tactccgatggctccctcaagatagtgcctggacacgcccggtgccagcctggaggtggg
cccccctctcctcctcctggcatgcccggccagcccctgccttctccgacgcgacttcac
ctggggggtgggcggaactcaaacgccaacggctacgtgcgcttacaactgggaggggag
gaccggggaggccttgggcaccccctgcctgaactcgccgacgaactgagacgcaaactg
cagcagcgccagcccctgcccgactccaaccccgaggagtcatcagtatga

KEGG   Oryctolagus cuniculus (rabbit): 100346590
Entry
100346590         CDS       T03373                                 
Symbol
SEMA4D
Name
(RefSeq) semaphorin 4D
  KO
K06521  semaphorin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100346590 (SEMA4D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100346590 (SEMA4D)
CD molecules [BR:ocu04090]
 Proteins
  100346590 (SEMA4D)
SSDB
Motif
Pfam: Sema ig PSI Ig_3 Ig_2 DUF3891 I-set
Other DBs
NCBI-GeneID: 100346590
NCBI-ProteinID: XP_002708312
Ensembl: ENSOCUG00000012955
UniProt: G1T4F3
LinkDB
Position
1:78351777..78439706
AA seq 864 aa
MRMRAPVGGLLSALAVVFGTAVAFAPVPRITWEHEEVQLVQFHKPGIYNYSALLLSEDQD
TLYVGAREAVFALNALDISEKQHEAYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLSLTTFQFLGRSEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPEGAEAEDDRVYFFFTEVSV
EYEFIFKLLIPRIARVCKGDQGGLRTLQKKWTSFLKARLTCSRPDSGLVFNVLRDVFVLR
GPGLREPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSRGKYMQSATVEQSHTKWVRYNG
PVPTPRPGACIDAEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTRALDGTLYDVMFMSTERGALHKAVSLESEVHIIEETQLFQDLQPIQTLLLSS
KKGRRFVYAGSNSGVVQAPLAFCGKHSSCEDCLLARDPYCAWSLPEAACVALHQTEGPGR
GLIQDMSGDMSACPDKGKESFRQHFFKHGGTAELRCSHKSNLARVVWKFQNGVLKAESPK
YGLVGRRHLLIFNLSEGDSGVYQCLLEERVRNKTVSQVVAKHVLEVKLLPRPPAAPTSPV
AHSESGSRVAPKVSVAATQGSSPPTPTVRATSPGATTPAPARPAATDASCEPKIVINTVP
QLHSEKTLYLKSSDNRLLMSLFLFFFVLCLCLFSYNCYHGYLPGQCLKFRSALLLGKKKP
KSDFSDLEQSVKETLVEPGSFSQQNGEQPKPALDTGYETEQDTLTSKVPTDREDSQRIDD
LSARDKPFDVKCELKFADSDADGD
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgaggatgcgggcccccgttggggggctgctctcggccctggcggtggtgtttggaacg
gcggtggcatttgcacctgtaccccggatcacctgggagcacgaagaggtgcagctggtg
cagttccacaagcccggcatctataactactcggccttgctgctgagtgaggaccaggac
accctgtacgtgggcgcccgggaagccgtcttcgccttgaacgcgctggacatctctgag
aagcagcacgaggcttactggaaggtttcggaagacaagaaagcaaaatgtgcagaaaag
gggaaatcgaagcagacagaatgcctcaactacatccgagtactgcagccactcagcgcc
acctccctctatgtgtgtgggaccaatgccttccagccggcctgtgaccatctgagccta
acaacctttcagtttctggggagaagtgaagacggcaaaggaaggtgtccgtttgacccg
gcacacagctacacatccgtcatggtcgatggagagctgtattccgggacgtcgtataac
ttcctgggaagcgaacctatcatctccaggaattcttcccacagccccctgaggacggag
tacgccatcccttggctgaacgagcccagcttcgtcttcgccgacgtgatccggaagagc
cccgagggggccgaggccgaggacgacagggtctacttcttcttcaccgaggtgtctgtg
gagtacgagttcatcttcaagctgctgatcccgcggatagcgcgggtgtgcaagggcgac
cagggaggcctgcggaccttacagaagaagtggacctccttcctgaaggccaggctcacc
tgctcccggccggacagcggcctggtcttcaacgtgctgcgggacgtcttcgtgctccgg
ggcccgggcctcagggagcccgtcttctacgcgctcttcaccccacagctgaacaacgtg
gggctgtcggccgtgtgtgcctacaacctgtccacagcggaggaggtcttctcccgcggc
aagtacatgcagagtgccacagtagagcagtcccacaccaagtgggtccgctacaacggc
ccggtgcccacgccgaggcctggagcgtgcatcgacgcggaggcacgggcggccaactac
accagctccctgaatttgcctgacaaaacgctgcagttcgtcaaagaccaccctctgatg
gatgactccgtgacccccatagacaacaggccccgcctcatcaaaaaggacgtgaactac
acccagatcgtggtggacaggacgcgggcgctggacgggaccctctacgacgtcatgttc
atgagcacagagcggggcgccctgcacaaagccgtcagcctggagagtgaggtgcacatc
atcgaggaaactcagcttttccaggacctgcagcccatccagaccctgctgctgtcttcc
aagaagggcaggaggtttgtctacgccggctccaactcgggcgtggtgcaggccccccta
gccttctgtgggaagcacagtagctgtgaggactgtctgctggcgcgggacccctactgc
gcctggagcctgcccgaggccgcctgcgtggccctgcaccagactgagggccccggcagg
ggactgatccaggacatgagcggcgacatgtcggcatgtcccgataaaggtaaagagagt
ttccggcagcattttttcaagcacggcggcacggccgagctcagatgctcacacaagtcc
aacctggcccgggtggtgtggaagttccagaacggcgtgctcaaggccgagagccccaag
tacggcctcgtgggcagaaggcacctgctcatcttcaacctttcggaaggagacagtggg
gtgtatcagtgcctgttggaggagcgggtccggaataagacggtctcccaggtggtggcc
aagcacgtgctggaggtgaagctgctcccacggccccccgcggcccccacctcgcccgtc
gcgcactctgagtcgggcagtagggttgcccccaaagtgtcagtggccgccacccagggc
tcctccccgccgacgcccactgtgcgggccacctcccccggggccaccaccccggcaccc
gccaggcccgcggccaccgacgcgtcctgtgaacccaagatcgtcatcaacacggtgcca
cagctgcactcagagaagacgttgtatctcaagtccagcgacaaccggctgctcatgtcc
ctcttcctcttcttcttcgtcctctgcctctgcctcttctcctacaactgttaccacggc
tacctgcccggccagtgcctgaagttccgctccgccctgctgctgggcaaaaagaagccc
aagtcggatttctcggacctggagcagagcgtgaaggagacgctggtggagcccgggagc
ttctcgcagcagaacggggagcagccgaagccggccctggacaccggctacgagacggag
caggacacgctcaccagcaaagtccccacggacagggaggactctcagaggatcgacgac
ctctctgccagggacaagccgttcgacgtcaagtgcgagctgaagttcgccgactcggat
gccgatggagactga

KEGG   Oryctolagus cuniculus (rabbit): 100346924
Entry
100346924         CDS       T03373                                 
Symbol
SEMA4B
Name
(RefSeq) semaphorin 4B
  KO
K06521  semaphorin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100346924 (SEMA4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100346924 (SEMA4B)
CD molecules [BR:ocu04090]
 Proteins
  100346924 (SEMA4B)
SSDB
Motif
Pfam: Sema PSI Ycf70 PSI_integrin
Other DBs
NCBI-GeneID: 100346924
NCBI-ProteinID: XP_002721553
Ensembl: ENSOCUG00000014916
LinkDB
Position
Un
AA seq 833 aa
MGRGIRAATPRDALLAGPLLLLVLPLLLLLLLLPPTRALSARISLPLGSEKRPVLRFEAE
DVSNYTALLLSQDGRTLYVGAREALFALSSSLSFLPGGEYQQLPWRADAERKQQCSFKGK
DPQRDCQNYVKILLPLNSSHLFACGTAAFSPLCTYINVRNFTLARDQAGNVLLEDGKGRC
PFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSHRPTKTESSLNWLQDPAFVASAF
IPESLGSPQGDDDKIYFFFSETGQKFEFIENTIVSRIARICKGDEGGERVLQQRWTSFLK
AQLLCSRPEDGFPFNVLQDVFTLSPSPEAWPETLFYGVFTSQWHRGASEGSAICVFTMDD
VQHAFNGLYKEVNRETQQWYTVTHPVPSPRPGACITNSARERKINSSLQLPDRVLNFLKD
HFLMDSKVRSQLLLLQPQARYQRVAVHRVSGLNRTYDVLFLGTGDGRLHKAVKVGSHVHI
IEELQVFQPGQPVQNLLLDTHRGLLYAASYLGVVQVPVANCSLYQSCGDCLLARDPYCAW
DGSACRHISLYQPELASRPWIQDVEGANAKDLCDTSSASPLSPIPTGKKPCEQVQFQPNT
VNTLACPLLSNLATRLWLHNSAPVNSSASCRVLPTGDLLLVGGQQGLGRFECWAVEGGFR
QLVASYCPEVVEDGAAEQTERGGSVPVVINTSRVSAPAAGKASWGSDRSYWNEFLVMCTL
FGLAVVLLVLFFLYRHRDGMKVFLKQGECASVHPKARPVALPPETRPLNGVGPPSTPLDH
RGYQALSDSSPGPRVFTESEKRPLSVQDSFVEVSPVCPRPRVRLGSEIRDSVV
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgggccgagggattcgggccgccaccccgcgggacgcgctgctggccgggccgctgctg
ctgctcgtgctaccgctgctgctgctgctgctgctgctgcccccgacgcgcgcgctcagc
gcccggatcagcctgccactgggctcggaaaagcggccggtgctccgatttgaagctgag
gacgtgtccaactacacggcccttctgctgagccaggacgggaggaccctgtacgtgggg
gcccgggaggccctctttgccctcagtagcagcctcagcttcctgcccggcggggagtac
cagcagctgccgtggagggcagatgcggagaggaagcagcagtgcagcttcaagggcaag
gacccacagcgtgactgccaaaactatgtcaagatcctcctgccactcaacagcagccac
ctgttcgcctgcggcacggccgccttcagccccctgtgcacctacatcaacgtgaggaat
ttcactctggcgcgggaccaagccgggaacgttcttctggaagatggcaagggccgctgt
ccctttgaccccaacttcaagtccacagccctggtggttgatggtgagctgtacactgga
acagtcagcagcttccaagggaacgacccggccatctcccggagccaaagccaccgcccc
accaagacagagagctccctcaactggctgcaagacccagcctttgtggcctcagccttc
attcccgagagcctgggcagcccgcagggggacgacgacaagatctacttcttcttcagc
gagaccggccagaagtttgagttcatcgagaacaccatcgtgtcccgcatcgctcgcatc
tgcaagggcgatgagggcggcgagcgggtgctgcagcagcgctggacgtccttcctgaag
gcccagctgctgtgctcgcggcccgaggacggcttccccttcaacgtgctgcaggacgtc
ttcacgctgagccccagccccgaggcctggcctgagaccctcttctacggggtcttcacc
tcccagtggcacaggggcgcctcggagggctcggctatctgtgtgttcaccatggacgac
gtgcagcacgccttcaacggcctctacaaggaggtgaaccgggagacgcagcagtggtac
accgtgacccacccggtgccctccccccggcctggagcgtgcatcaccaacagtgcccgg
gagaggaagatcaactcgtccctgcagctccccgaccgcgtgctcaacttcctcaaggac
cacttcctgatggacagcaaggtccgcagccagctgctgctgctgcagcctcaggcccgc
taccagcgcgtggccgtccaccgcgtctctggcctgaaccgcacctatgacgtcctgttc
ctgggtaccggtgacgggcggctgcacaaggcagtgaaggtgggctcgcatgtgcacatc
attgaggagctgcaggtcttccagccgggacagcccgtccagaacctgctcctggacacc
cacaggggactgctgtacgcggcctcgtacttgggcgtggtccaggtgccggtggccaac
tgcagcctgtaccagagctgcggggactgcctcctcgcccgcgacccctactgcgcctgg
gacggctccgcctgccgccacatcagcctctaccagcctgagctggcctccaggccatgg
atccaggatgtcgagggggccaacgccaaggacctctgcgacacctcctcggccagcccc
ttgtctcccataccaacaggcaagaagccctgtgagcaggtccagttccagcccaacacc
gtgaacaccttggcctgcccgctcctgtccaacctggccacccggctctggctgcacaac
agcgcccccgtcaactcctcggcctcctgccgcgtgctgcccacgggggacctgctgctg
gtgggcggccagcaggggctggggcgcttcgagtgctgggcagtggaggggggcttccgg
cagctggtggccagctactgcccagaggtggtggaagatggggccgcggagcagacggag
cggggcggcagcgtgccggtcgtgatcaacacttcacgtgtgagcgcgccggcggccggt
aaggccagctggggctccgacaggtcctactggaacgagttcctggtgatgtgcacgctc
ttcgggctcgcggtggtgctgcttgtcctgttcttcctctaccggcaccgcgacggcatg
aaggtcttcctgaagcagggcgagtgcgccagcgtgcaccccaaagcccgccccgtggcc
ctgccgcccgagacccggccgcttaacggtgtcggcccgcccagcacccccctcgaccac
cgaggctaccaggccctgtccgacagttccccagggccccgagtcttcacggagtccgag
aagaggccgctcagtgtccaggacagcttcgtggaggtgtctcccgtgtgcccccggccc
cgcgtccgcctgggctccgagatccgggactccgtggtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100347884
Entry
100347884         CDS       T03373                                 
Symbol
SEMA4F
Name
(RefSeq) ssemaphorin 4F
  KO
K06521  semaphorin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100347884 (SEMA4F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100347884 (SEMA4F)
CD molecules [BR:ocu04090]
 Proteins
  100347884 (SEMA4F)
SSDB
Motif
Pfam: Sema4F_C Sema PSI CbiM CcmD PSI_integrin
Other DBs
NCBI-GeneID: 100347884
NCBI-ProteinID: XP_008252416
Ensembl: ENSOCUG00000004668
LinkDB
Position
2:complement(111867712..111897524)
AA seq 770 aa
MLASTAQPRPGPGPPPASPLPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSYLTRFTVP
QTYNYSVLLVDPASHTLYVGARDTIFAISLPFSGEKPRRIDWIVPEAHRQNCRKKGKRED
ECHNFVQILAIANASHLLTCGTFAFDPKCGVIDVSSFQQVERLESGRGKCPFEPAQRSAA
VMAGGVLYAATVKNYLGTEPIISRAVGRAEDWIRTETLPSWLNAPAFVSAVALSPAEWGD
EDGDEEIYFFFTETSRAFDSYEPIKVPRVARVCAGDLGGRKTLQQRWTTFLKADLLCPRP
EHGRAPSVLQDMAVLRPEPGTGTPIFYGIFSSQWEGAAISAVCAFQPQDIRKVFSGPFRE
LKHDCNRGLPVLDNDVPQPRPGECITNNMKLQQFSSSLSLPDRVLTFIRDHPLMDKPVSP
ADSHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLTL
FPEPQPVENMKLYHGWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSPRLDACV
AHAGEHRGLVQDMESADVSSLCPKEPGEHPVVFEVPVATAAHVILPCSPSSAWASCVWHR
PSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGAARVVAAYSLVWGSQRGLPSQAHTVG
AGLAGFVLGVLAASLTLLLIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPS
PEDERLPLALAKRGSGFGGFPPPFLLDPCSSPAHIRLTGAPLATCDETSI
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctggcctctaccgcgcagccccgcccgggtcccgggccgcctccggcctcgccctta
ccgctgctgctgctggcagtgctgagcggcccggtgtccggccgcgtccctcgctcggtg
cccaggacctcgcttcccatctccgaggctgactcctatctcacccggttcaccgtccct
cagacgtacaattactctgtcctccttgtggatcctgcttcccacacactttatgttggc
gcccgggacaccatcttcgctatatccctgcccttctcgggggagaaaccacgcaggatt
gattggattgtgccggaagctcacagacagaactgtaggaagaaaggcaagagagaggac
gaatgtcacaattttgtccagattctcgccattgccaatgcttctcacctcctcacttgt
ggcaccttcgcctttgacccgaagtgcggggttattgatgtgtccagtttccagcaggtt
gaaagacttgagagtggccgggggaaatgtccttttgagccagctcagcggtcagcagct
gtaatggctgggggggtcctctatgccgccacggtgaaaaactacctggggacggagccg
attatctcccgggctgtgggtcgtgccgaggactggattcgcacagagactttgccatcc
tggcttaacgccccagcctttgtttcagccgtggccttgagcccagcggagtggggggat
gaagatggagacgaggaaatctacttcttctttacggagacctctcgagcatttgactcc
tacgagcccattaaggtcccacgggtggcccgcgtgtgtgcgggggaccttgggggccgt
aagaccctccagcagaggtggacgacatttctgaaggccgacctgctgtgtcccaggccc
gagcacggcagagctcccagtgtccttcaggacatggccgtccttcgaccggagcctgga
acgggcacccccatcttttatggcatcttttcctcacagtgggagggggctgccatctct
gcagtttgtgccttccaaccacaagacattcggaaagtgttcagtggtcccttcagagag
ctaaagcatgactgcaacaggggactacctgttttggacaacgatgtgccccagcctaga
cctggagagtgcatcaccaacaacatgaagctgcagcagttcagttcatctctctccctg
cccgaccgtgttctcaccttcatccgggatcacccgctgatggacaagccagtgtctcca
gctgacagccatcccctcctggtcaccaccgacacagcctatctcagagtcgtggcccac
agggtgaccagcctctcagggaaagagtatgatgtgctctacctggggacagaggacgga
cacctgcaccgagcagtgcgcatcggagcccagctcagcgtcctggaggatctcacttta
ttcccagaaccacagccggttgagaacatgaaattgtaccacggctggctgctggttggc
tcccgtaccgaggtgacacaagtgaacacaaccaactgtggccgtctgcagagctgctca
gaatgcatcctggctcaggaccctgtctgtgcctggagcccccggctggatgcctgtgtg
gcccatgctggggaacaccgagggctggtccaagacatggagtcagcagacgtctcttct
ttgtgtcccaaagaaccaggagaacacccagtagtgtttgaagttccagtggctacagct
gcacatgtgatcttgccgtgttcccccagctcagcatgggcgtcctgcgtgtggcaccgg
cccagtggagtgactgcactcaccccacggcgggatgggctggaggtggtggtgacccct
ggggccatgggcgcttatgcttgtgagtgtcaggagggcggggcagctcgtgttgtagca
gcctacagcttggtatggggcagccagcggggccttccgagccaggctcatacagtgggg
gctggcctggccggttttgtactgggggttcttgcagcatccctgactcttctcctgatt
ggtcggcgtcagcagcgacggcgacagagagaacttctggctagagacaaggtgggcttg
gatctaggggccccaccgtctgggaccacaagctacagccaagaccctccttctccttct
cctgaagatgagcggctgcccctggccctggccaagaggggcagtggctttggtggcttc
cctccacccttcctgcttgacccttgctcaagcccagcccacattcggctaactggggct
cctctagccacgtgtgatgaaacatccatctag

KEGG   Oryctolagus cuniculus (rabbit): 100348771
Entry
100348771         CDS       T03373                                 
Symbol
SEMA4G
Name
(RefSeq) semaphorin 4G
  KO
K06521  semaphorin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100348771 (SEMA4G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100348771 (SEMA4G)
CD molecules [BR:ocu04090]
 Proteins
  100348771 (SEMA4G)
SSDB
Motif
Pfam: Sema PSI Sema4F_C Ig_3 Ig_2 ig
Other DBs
NCBI-GeneID: 100348771
NCBI-ProteinID: XP_002718707
Ensembl: ENSOCUG00000002737
LinkDB
Position
18:49065922..49079027
AA seq 839 aa
MLGRLWPTLLSFLLATAVPGLSVRRPSRELDATPRTTIPYEELSGTRHFKGQAQNYSTLL
LEEASGRLLVGARGALFSLSAQDIGDGAHKEIRWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNATHLYACGTHAFQPLCAAIDAEAFTLPTSFEEGKEKCPYDPARGFTGLVIDGGL
YTATRYEFRSIPDIRRSRHPHSLRTEEAPMHWLNDAEFVFSVLVRESEASAVGDDDKVYY
FFTERTAEESSSSFSQSRSNHRVARVARVCKGDLGGKKILQKKWTTFLKARLICHIPQYE
TLRAVCSLDAEASARTHFYAAFTLTTQWKTLEASAICRYDLAEVQAVFAGPFMEYQDGAR
RWGRYEGGVPEPRPGSCITDSLRSRGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLL
LKRNVRYTHLAGTAVITPAGLTYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFSEPQSV
ENLVISPVQHSLYVGAPSGVIQLPLSSCSRYRTCYDCILARDPYCGWDPSTHACKAATTT
ANRTALIQDMERGNRGCEGSRETGPPPPLKIRSVLRGDDVLLPCDQPSNLARALWLLNGS
KGLSDGQHGYRVGVDGLLVTDTQPEHSGNYGCYAEENGLRTLLASYSLTVRPITPAPAPQ
APVTSAAQLEPDVRLLYVLAIATLGSLCLILAFSLLYVACLRGGRGGRRRKYSLGRAGRA
GGSAVQLQTVSGQCPGEEDECDDGEGAGGLEGGCLQIIPGEGAPAPPPPPPPPPPAELTN
GLVALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLIEQLDESSV
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgttggggaggctctggcccacccttctgagcttcctcctagcaaccgcagtccctgga
ctctccgtgcgacgtccatccagagagctggatgccacccctcggaccaccatcccctat
gaagagctctccgggacccggcacttcaagggccaggcccagaactactcgacgctgcta
ttggaagaggcctcggggaggctgctggtgggagcccgaggcgccctgttctctctcagc
gcccaggacataggagatggtgctcacaaagagatccgctgggaggcctccccagagatg
caaagcaaatgccatcagaaagggaaaaacaaccagacagagtgcttcaaccatgtgcga
ttcctacagcggctcaatgccacccacctctatgcatgtgggacccacgccttccagccc
ctctgtgcagccattgatgctgaggccttcactttgccaaccagtttcgaggaggggaag
gagaagtgtccttatgacccagcccgtggcttcacaggccttgtcattgacggaggcctc
tacacagccacgcggtacgaattccggagcatccctgacatccgccggagccgccaccca
cactctctgagaaccgaggaggcaccgatgcactggctcaatgatgctgagtttgtgttc
tccgtcctggtgcgggagagcgaggccagcgccgtgggcgacgatgacaaggtttactac
tttttcacggagcgcactgccgaggagagctccagcagcttctctcagagccgcagcaac
caccgcgtggcccgtgtggcccgggtgtgcaagggagacctgggaggaaagaagatcctg
cagaagaagtggacgaccttcctgaaggctcgcctcatctgccacatcccccagtatgag
actctgcgtgcggtctgcagcctggacgcggaggcctcagcgcgcacgcacttctacgcg
gccttcacgctgaccacacaatggaagaccctggaggcctcagccatctgccgctatgac
ctggccgaggtgcaggccgtcttcgcaggccctttcatggagtaccaggatggtgcccgg
cgctggggccgctacgagggtggagtgcctgagccccggcctggctcatgcatcacagac
tccctgcgcagcagaggctacaactcgtcgcaagacctgccgtccctggtcctggacttt
gtgaagctgcacccgctgatggctcggcccgtggtgcccacgcgcggacggccactgctg
ctcaagcgcaatgtgcgctacacacacctcgccgggacagccgtcatcacgccggcggga
ctcacctatgatctgctgtttctgggcacagctgacggctggatccataaggccgtggtc
ctgggctctgggatgcacataattgaggagacccaagtgttcagtgagccccagtctgtg
gagaacctggtcatctctccagtgcagcacagcctctacgtgggggcccctagcggagtc
atccagctaccgctgtccagctgctcccgctaccgtacctgctatgactgcatcctggcc
cgggacccctactgtggctgggaccccagcacccatgcctgcaaggcagccaccaccaca
gccaacaggacagcactgatacaggacatggagaggggaaaccgaggatgcgagggcagc
agggaaacagggccaccaccaccactgaagatccgctctgtgctccgcggcgatgacgtc
ctcctgccgtgtgaccagccatccaacctggcccgggccctgtggctactcaatgggagc
aagggcctgagcgatgggcagcatggctaccgcgtgggggtggacgggctgctggtgaca
gacacccagccagagcacagtggcaactacggctgctacgccgaggagaacggcctgcgc
acgctgctggcctcctacagcctcacggtgcggcccatcacgcctgccccagctccacaa
gctcccgtcacgtctgcggcacagctggagcccgacgtcaggctgctctacgtgctggcc
attgccacacttggtagcctctgccttatcctggccttctccctcctctacgtggcctgt
ttgcggggaggcagaggagggcgccgacggaagtactcgctgggccgggctggccgggca
gggggctctgctgtgcagctgcagacggtctcaggccagtgtcctggagaggaagacgag
tgtgatgacggggagggggccgggggcctggagggtggctgccttcagatcatccccgga
gaaggagccccggcaccaccgcccccaccccctcctccgcctccggctgagctgaccaac
gggctggtggcgctgcccagcaggctgcggaggatgaacggcaacagctacgtgctcctg
aggcagagcaacaatggcgtgcctgcggggccctgctcctttgccgaggaactcagccgc
atcctggagaagcggaagcacacgcagctcatagagcagctggacgagagctctgtctga

DBGET integrated database retrieval system