KEGG   Oryctolagus cuniculus (rabbit): 100342069
Entry
100342069         CDS       T03373                                 
Symbol
IFIT1B
Name
(RefSeq) interferon-induced protein with tetratricopeptide repeats 1B
  KO
K14217  interferon-induced protein with tetratricopeptide repeats 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100342069 (IFIT1B)
SSDB
Motif
Pfam: TPR_2 TPR_12 TPR_1 TPR_11 TPR_19 TPR_8 TPR_14 TPR_7 TPR_16 TPR_10 TPR_17 TPR_MalT ANAPC3 TPR_15 TPR-S TMF_TATA_bd
Other DBs
NCBI-GeneID: 100342069
NCBI-ProteinID: XP_008268389
Ensembl: ENSOCUG00000005445
LinkDB
Position
18:37294792..37303296
AA seq 521 aa
MQSCLETPSIYKHRGCLRSPRPLWTNLGGAASQTDLSPEKHLLPCSTMSEKSHGYQINDR
LVQVRCHFTWELLIEDIEMPDLENRIWEEIQFLDTEHKVGYNLLAYVKHLQGKHEDALEN
LKEAEEVVQGDQADHSDVRSLVTWSNYAWVYYHMGRLADAQTYLDKVENTCQKSADPSRY
RMECPEMDCEEGWALLKCGRKNYERAKACFEKALEADPENPEFNTGYAITVYRLDYPAKR
PYDVSDAFSLQPLRKAIRLNPQDAYLKALLALKLQDLGEEAEGRECMEEALAHTSSQTYV
FRYAAKFFRRQGRVDEALKYLKRALKATPRSVFLHHQIGLCYREQMIQIKNATHMQPRGR
DRENVDRLVQLAINEFQKASVLKPTFELAHVHLAEMYAEIRQYKEAEEHFQKALCIPNSD
DHIQQEIHYSYGNFLAYHWKSEDKAITQYLKGLKIEKVSYAREKLLKALERLAERRVNRN
VQVVESTALLGLIHKLRGEVSKALLCYEKALRLAADLNSMF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgcaaagttgcttggagacaccttccatatataagcaccgtggttgtctgagaagccct
agacctctgtggacaaaccttggaggagcagcctcccagactgacttaagccctgaaaag
cacctgttgccttgcagcaccatgagtgagaaatcccatggatatcagattaatgataga
ctggttcaggtgagatgccattttacatgggagttgttaattgaagacattgaaatgccg
gatttagaaaacaggatctgggaagagattcaatttctagacactgaacacaaggtagga
tacaacctcctggcctatgtgaaacacctgcaaggcaagcatgaggatgccctggagaac
ctgaaagaagcagaagaggtggttcagggagaccaggctgaccactcagatgtgaggagt
ctggtgacctggagcaactacgcctgggtgtactaccacatgggcaggctggcagatgcg
cagacgtacctggacaaggtggagaacacgtgccagaagtctgcagacccctcccgctat
agaatggagtgccctgagatggactgtgaggaaggctgggctttgctgaagtgtggaaga
aaaaattatgagcgggccaaggcctgctttgagaaggctctggaagcagaccctgagaac
cccgaattcaacacagggtatgcaatcactgtctaccgcctggattaccctgccaaaaga
ccatacgatgtcagtgatgcgttttctctgcagcccttaaggaaggccatcaggctcaat
ccacaagatgcataccttaaagctctgcttgctctgaagctgcaggatttaggagaggag
gccgaaggaagagagtgcatggaggaagctctggctcacacgtcctcccagacctatgtc
tttcgatacgcagccaagtttttccgcagacaaggccgtgtggatgaagctctgaagtac
ctaaaaagggccttgaaggcaacacccagatctgtctttcttcatcaccagataggcctc
tgctacagggaacaaatgatccaaataaagaatgctacccacatgcagcctagaggacgg
gatagggagaatgtggacagattggttcaattagccataaatgaatttcaaaaggcttca
gttctaaagccgacatttgaattggctcatgttcacctggctgagatgtatgcagaaata
cgccagtacaaagaggctgaggaacattttcagaaagcattatgcatcccgaacagtgat
gatcacatccaacaagaaattcattacagctacggtaatttcttagcatatcactggaaa
tctgaagacaaagccatcactcagtatctaaaaggtctaaaaatagaaaaagtgtcttat
gccagggaaaaactgctcaaggctttagagagattggcagaaagacgtgtgaaccggaat
gtccaagttgtggaaagtaccgccctccttgggctcatccacaaattgagaggggaagtg
agcaaagccctgctgtgttatgagaaggctctaaggctggctgctgacctcaactccatg
ttctga

KEGG   Oryctolagus cuniculus (rabbit): 100342826
Entry
100342826         CDS       T03373                                 
Name
(RefSeq) interferon-induced protein with tetratricopeptide repeats 1-like
  KO
K14217  interferon-induced protein with tetratricopeptide repeats 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100342826
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_12 TPR_8 TPR_14 TPR_19 TPR_11 TPR_MalT TPR_16 TPR_7 TPR_17 TPR_15 TPR_9 NatA_aux_su ST7 TMF_TATA_bd EST1_DNA_bind Sec16_C
Other DBs
NCBI-GeneID: 100342826
NCBI-ProteinID: XP_008268394
UniProt: G1U3X3
LinkDB
Position
18:37337971..37345236
AA seq 479 aa
MSERAEEHPLKDRLQKLRCHFTWGLLIEDTGLPDLEDRILEEIQFLDTEHKVGIYNLLAY
VKHLQGKHEDALENLKEAEEVVQGDQADHSDVRSLVTWGNYAWVYYHMGRLADAQTYLDK
VENTCQKSANPSLYRMQCPEMDCEEGWALLKCGGKNYERAKACFEKALEADPENPEFNTG
YAITVYRLDYPAKRPCDVSDAFSLQPLRKAVRLNPQDAYLKALLALKLQDVGQKAEGREC
LEEALAHTSSQTYVFRYAAMFFRRQGRVDEALKYLKMALKATPSSAILHHQIGLCYREQM
IQIKKTTHLQPTEQDRDNVDRLVQLVIFHFEYAVKQKPTFEFAYIHLAHMYITAGDLEKA
EDTFQKVLCMTPAREHILQDIHFHYGQFQQFQKKSEVDAITHYLKAIKIGKDSYARDKSI
NASKQLASKKLKTNAFDLEGWSLQGLVHRLKGELKEALECYEQALRLAADCDNKVACGP
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagtgagcgtgctgaggagcatccgctgaaggacaggctgcagaagctgagatgtcac
ttcacatgggggctgctcatcgaagacactgggttgcctgacctagaagacagaatcctg
gaagagattcaatttctagacactgaacacaaggtaggaatatacaacctgctggcctat
gtgaaacacctgcaaggcaagcatgaggatgccctggagaacctgaaagaagcagaagag
gtggttcagggagaccaggctgaccactcagatgtgaggagtctggtgacctggggcaac
tacgcctgggtgtactaccacatgggcaggctggcagatgcacagacgtacctggacaag
gtggagaatacgtgccagaagtctgcaaacccctccctctatagaatgcagtgtcctgag
atggactgtgaggaaggctgggctttgctgaagtgtggaggaaagaactatgagcgggcc
aaggcctgctttgagaaggctctggaagcagaccctgagaaccccgaattcaacacaggg
tatgcaatcactgtctatcgcctggattaccctgccaaaagaccatgcgatgtcagtgat
gcgttttctctgcagcccctaaggaaggccgtcaggctcaatccacaagatgcatacctt
aaagctctgcttgctctgaagctgcaggatgtaggacagaaggccgaaggaagagagtgc
ttggaggaagctcttgctcacacatcctcccagacctatgtctttcgatacgcagccatg
tttttccgcagacaaggccgtgtggatgaagctctgaagtacctaaaaatggccttgaag
gcaacacccagctctgccattcttcaccaccagataggcctctgctacagggaacaaatg
atccaaataaagaaaactacccacttgcagcctacagagcaggacagagacaatgtggac
agactggttcaattagtcatatttcactttgaatatgctgtcaaacaaaagcccacgttt
gagtttgcttatatacacctggcacacatgtatataaccgcaggcgatcttgaaaaagct
gaagatactttccaaaaagtgctgtgcatgacaccagcccgggaacacatactgcaagat
atacacttccactacggtcaatttcaacaatttcaaaagaaatccgaagttgatgccatt
acccattatttaaaggcaataaaaataggaaaggactcatatgccagggataaaagtatc
aatgcctcgaaacaattggcttcaaagaaactaaagacaaatgcatttgacctggaaggc
tggagtctccaggggttggtccacaggttgaaaggagaattgaaagaagccctggagtgc
tatgagcaggccctgagactagctgctgactgtgataacaaggtggcatgtggcccctag

DBGET integrated database retrieval system