KEGG   Oryctolagus cuniculus (rabbit): 100342147
Entry
100342147         CDS       T03373                                 
Symbol
ANAPC16
Name
(RefSeq) anaphase promoting complex subunit 16
  KO
K25229  anaphase-promoting complex subunit 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342147 (ANAPC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342147 (ANAPC16)
   04114 Oocyte meiosis
    100342147 (ANAPC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100342147 (ANAPC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342147 (ANAPC16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342147 (ANAPC16)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342147 (ANAPC16)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100342147 (ANAPC16)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100342147 (ANAPC16)
SSDB
Motif
Pfam: ANAPC16 DUF2110
Other DBs
NCBI-GeneID: 100342147
NCBI-ProteinID: XP_002718479
Ensembl: ENSOCUG00000016767
UniProt: G1TCB4
LinkDB
Position
18:complement(15179269..15190590)
AA seq 110 aa
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggctgcctcgtcgtcgtcctcctcggctggtggggtcagtgggagttctgtcactgga
tctggtttcagtgtgtcagacctcgccccaccacggaaagcccttttcacctaccccaaa
ggagctggagagatgttagaagatggctctgagagatttctctgcgagtccgttttcagc
tatcaagtggcatccacacttaaacaggtgaaacatgatcagcaggttgctcggatggaa
aaactcgctggtttggtagaagagctggaggccgatgagtggcggttcaaacccatcgag
cagctgctggggttcacgccctcttcaggttaa

KEGG   Oryctolagus cuniculus (rabbit): 100342311
Entry
100342311         CDS       T03373                                 
Symbol
ANAPC10
Name
(RefSeq) anaphase promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342311 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342311 (ANAPC10)
   04114 Oocyte meiosis
    100342311 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100342311 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342311 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342311 (ANAPC10)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342311 (ANAPC10)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100342311 (ANAPC10)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100342311 (ANAPC10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 100342311
NCBI-ProteinID: XP_008265617
Ensembl: ENSOCUG00000001819
UniProt: G1SG69
LinkDB
Position
15:19564191..19676952
AA seq 185 aa
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGRFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccacaccaaacaagacgcctcctggtgctgaccctaaacaattggaaaggactgga
acagtacgggaaattgggtcacaagctgtttggtcactttcatcttgcaaaccaggattt
ggagtggatcagttaagagatgacaatcttgaaacttactggcaatcagacggctcccag
cctcatttagtgaacatccaattcagaagaaagacaacagtgaagacattatgtatttat
gcagactacaaatctgatgaaagctatactccaagcaagatctcagtcagagtaggaaat
aattttcacaaccttcaagaaattcggcaacttgaattggtggaaccaagtggctggata
catgttcctttaactgataatcataagaagccaactcgcaccttcatgatacagattgct
gttctagccaatcaccaaaatggaagagacactcacatgagacaaattaaaatatacaca
ccagtggaggagagctccattggtagatttcctagatgtacaactattgatttcatgatg
tatcgttcaataaggtga

KEGG   Oryctolagus cuniculus (rabbit): 100342681
Entry
100342681         CDS       T03373                                 
Symbol
ANAPC15
Name
(RefSeq) anaphase promoting complex subunit 15
  KO
K25228  anaphase-promoting complex subunit 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342681 (ANAPC15)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342681 (ANAPC15)
   04114 Oocyte meiosis
    100342681 (ANAPC15)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100342681 (ANAPC15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342681 (ANAPC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342681 (ANAPC15)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342681 (ANAPC15)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100342681 (ANAPC15)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100342681 (ANAPC15)
SSDB
Motif
Pfam: ANAPC15 RNA_pol_Rpc4 DUF2457 V_ATPase_I
Other DBs
NCBI-GeneID: 100342681
NCBI-ProteinID: XP_002708765
LinkDB
Position
1:144244472..144248591
AA seq 121 aa
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASE
HYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWM
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtccaccttgttcccttccctcttccctcgtgtgactgagacactgtggtttaatctg
gatcgaccctgtgtggaggagacagagctgcagcagcaggaacagcagcatcaggcgtgg
ctccaaagcattgcagagaaagacaacaatctggtacctatcggcaagccagcctcagag
cactatgatgatgaggaagaagaagatgatgaagacgatgaggacagtgaagaagactca
gaggatgatgaggacatgcaggacatggacgagatgaatgactacaacgagtcacctgat
gatggagaggtcaatgaggtggacatggaaggcaacgaacaggatcaggaccagtggatg
atctag

KEGG   Oryctolagus cuniculus (rabbit): 100343351
Entry
100343351         CDS       T03373                                 
Symbol
ANAPC11
Name
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100343351 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100343351 (ANAPC11)
   04114 Oocyte meiosis
    100343351 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100343351 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100343351 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343351 (ANAPC11)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100343351 (ANAPC11)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     100343351 (ANAPC11)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100343351 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-Nse zf-RING_UBOX
Other DBs
NCBI-GeneID: 100343351
NCBI-ProteinID: XP_017206343
Ensembl: ENSOCUG00000027501
UniProt: G1TPK6
LinkDB
Position
Un
AA seq 84 aa
MKVKIKCWNGMATWLWVANDKNCGICRMALNGCGPDCKMPGDNCLLVWGQCSHCFHMHCI
LKWLNTQQVQQHCPMRRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaagatcaagtgctggaacggcatggccacctggctttgggtggccaacgac
aagaactgcggcatctgccggatggcattaaatggctgcggccccgactgcaagatgccg
ggagacaactgcctgctagtctggggccagtgctctcactgcttccacatgcactgcatc
ctcaagtggctcaacacacagcaggtgcagcagcactgccccatgcgccggcaggagtgg
aagttcaaggagtga

KEGG   Oryctolagus cuniculus (rabbit): 100345196
Entry
100345196         CDS       T03373                                 
Symbol
CDC27
Name
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100345196 (CDC27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100345196 (CDC27)
   04114 Oocyte meiosis
    100345196 (CDC27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100345196 (CDC27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345196 (CDC27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100345196 (CDC27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345196 (CDC27)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100345196 (CDC27)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100345196 (CDC27)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100345196 (CDC27)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100345196 (CDC27)
SSDB
Motif
Pfam: TPR_1 ANAPC3 TPR_2 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_9 TPR_6 ChAPs PPTA TPR_MalT TPR_20 Cas_Cas02710
Other DBs
NCBI-GeneID: 100345196
NCBI-ProteinID: XP_002719506
Ensembl: ENSOCUG00000010815
LinkDB
Position
19:complement(46557539..46643818)
AA seq 824 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSSGAPTKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSAGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatttggcaagcactaaatcactatgct
tatcgagatgcagttttcctcgcagaacggctgtatgcagaagtgcactccgaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccacagtgtaaatacctgcttgcaaaatgttgtgtt
gatctgagcaagcttgcagaaggggaacagatcttatctggtggagtatttaataagcag
aaaagccatgatgatatcgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtgtattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccagacctttaaattaacatctttacagaactttagcagctgtctg
cccaacacttgcacaacactagtatctaatcatagtttatctcacagacagcccgagaca
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttca
aattcaaagtactccttgaatacagattcctcagtgtcttacattgattcagctgtgatt
tcaccagatactgtccctcttggaacaggaacttctatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttgttaggaggaccagctgctcttagcccattaaccccg
agttttgggattttgccattagaaaccccaagtcctggagacggatcctatttacaaaac
tacactaatacaccctctgtaattgacgtgccatccagtggagcccctacaaaaaagtct
gttgcaagaattggccaaactggaacaaagtctgtcttctctcagagtggaaatagtcga
gaggtaactccaattcttgttgcacaaacacaaagtgctggcccacaaacaagtacaaca
cctcaggtattgagccccactattacatctcccccaaacgcactgcctcgaaggagttct
cggcttttcaccagtgacagctctacaaccaaggagaatagcaaaaaattaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggcataact
caacctaatataaatgatagcctggaaattacaaaattggattcttccatcatttcagaa
gggaaaatatccacaatcacacctcagatccaggcttttaatctgcaaaaagcagcagca
ggtttgatgagccttcttcgtgaaatgggcaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattttgagccacctaccttctcaccactacaacactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaagaattgagaattacagagttgaaggcatggagatctactct
acgacactttggcatcttcaaaaagatgttgctctttcagttctttcaaaagacttaaca
gacatggataaaaattcaccagaggcttggtgtgccgcaggaaactgtttcagtctgcaa
cgggaacatgatattgcaattaaatttttccagagagctatccaggttgatccaaattat
gcttatgcctatactctattaggacatgagtttgtgttgactgaagaactagacaaagca
ttagcttgttttcgaaatgctatcagagtcaatcctagacattacaacgcatggtatggt
ttaggaatgatttattataagcaagaaaaattcagccttgcagaaatgcatttccagaaa
gcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcagcat
gcactgaaaaagtctgagaaggctttggataccctaaacaaagccattgttattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaagcaaattgttcccaaagaatcccttgtttac
ttcttaataggaaaggtttacaagaaattaggtcagacacacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aaacgctatctcccagatgacgaagagccaataactcaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcagacgacacacaactacatgcagctgaa
agtgatgaattttaa

KEGG   Oryctolagus cuniculus (rabbit): 100345665
Entry
100345665         CDS       T03373                                 
Symbol
CDC23
Name
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100345665 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100345665 (CDC23)
   04114 Oocyte meiosis
    100345665 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100345665 (CDC23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345665 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345665 (CDC23)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100345665 (CDC23)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100345665 (CDC23)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100345665 (CDC23)
SSDB
Motif
Pfam: TPR_1 ANAPC8 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 TPR_17 ANAPC3 TPR_12 DUF772 TPR_9 TPR_15 TPR-S
Other DBs
NCBI-GeneID: 100345665
NCBI-ProteinID: XP_002710281
Ensembl: ENSOCUG00000008382
UniProt: G1SV17
LinkDB
Position
3:complement(20485817..20513760)
AA seq 597 aa
MAASTSVVPVAVTAAVAPVLATNADFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPVTEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTSEMPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcgagtacgtctgtagtcccggtggctgtgacggcggctgtggcgcctgttctg
gccacgaacgccgatttctcagatttgcgggaaattaaaaagcagctgctgcttatcgca
ggccttacccgggagcggggcctgctgcacagtagcaaatggtcggcggagttggccttc
tccctcccggccctgcctttggccgagctgcagccgccgccgcctgttaccgaggaggat
gcccaggacatggatgcttacaccctggccaaggcctactttgatgttaaagagtatgat
cgggcagcacatttcctgcacggctgcaatagcaagaaagcctatttcctgtacatgtat
tccagatatctgtctggagagaaaaagaaggatgatgaaacagttgatagcctaggcccc
ttggaaaaaggacaagtgaaaaatgaggctcttagagaactgagagtggagcttagcaaa
aaacaccaagctcgggaacttgatggatttggcctttatctatatggtgtggtgcttcga
aaactggacttggtgaaagaggccattgatgtgtttgtggaggccacccatgttttacct
ttgcattggggagcctggttagaactttgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggcccttcagaagtatcagaatctcattgatgtgggcttttct
aaaagctcttatattgtttcccaaattgcagttgcctatcacaatatcagagatatcgac
aaagccctgtccatttttaatgagctaaggaagcaagacccttacaggattgaaaatatg
gacacattctccaacctgctttatgtcagaagtatgaaatctgaattgagttatttggct
cataacctctgtgagattgataaatatcgtgtagaaacatgctgtgtaattggtaattat
tatagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaattg
aatcctcggtacctaggggcctggacactgatgggacatgagtacatggaaatgaagaac
acctctgctgctatccaggcttacagacatgccattgaagtcaacaagcgggactacaga
gcctggtatggcctagggcagacctatgaaatccttaaaatgccattttactgcctttat
tattacagacgggcccaccagcttcggcccaatgattctcgtatgctggttgctttagga
gaatgttatgagaaactcaatcaactagtagaagccaaaaagtgttactggagagcttat
gctgtgggagatgtggagaagatggctctggtgaaactggcaaagcttcacgaacaattg
accgaatcagaacaggctgcccagtgctacatcaaatatattcaagatatctattcctgt
ggggaaatagtggaacacttggaggaaagcacagccttccgctatctggcccagtactat
tttaagtgcaagctgtgggatgaagcttcaacttgcgcccagaagtgttgtgcattcaat
gatacccgggaagaaggtaaggccttgcttcggcaaatcctacagctccggaaccaaggt
gaaactccgaccagtgagatgcctgctccctttttcctccctgcctcgctgtctgccaac
aacactcccacccgcagagtttctccactcaacttgtcttctgtcacaccataa

KEGG   Oryctolagus cuniculus (rabbit): 100348299
Entry
100348299         CDS       T03373                                 
Symbol
ANAPC1
Name
(RefSeq) anaphase promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100348299 (ANAPC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100348299 (ANAPC1)
   04114 Oocyte meiosis
    100348299 (ANAPC1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100348299 (ANAPC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348299 (ANAPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100348299 (ANAPC1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100348299 (ANAPC1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100348299 (ANAPC1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100348299 (ANAPC1)
SSDB
Motif
Pfam: Apc1_MidN Apc1_N APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 100348299
NCBI-ProteinID: XP_002709632
Ensembl: ENSOCUG00000012926
UniProt: G1TFT3
LinkDB
Position
2:complement(96748374..96847849)
AA seq 1944 aa
MSNFYEEKATMIAAGDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEEVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKTYSSYEVEKCICILQSSCINMHSIEGKDYIASLPFQVANV
WPTKYGLLFERSSSSHEVPPGPPREPLPTMFSMLHPLDEITPLVCKSGGLFGSTRVHYVV
DPAMKIVFLNIDPSIVMTYDSVQNVHSVWTLRRVKPEEENAVLKFSEQGGTPQNAATSSS
LTAHLRSLSKGDSPVASPFQNYSSIHSQSRSASSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNVSSHNQSPKRHSISHSPTSNSNGSFLAPETEPIVPELCIDHLWTETITNI
REKSSQASKVFITTDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSVTNIHAKDAA
PVEKIDTMLVLEGSGNLVLYTGVVRVGKVFIPGLPAPSLTMSNTMPRPSTPLDGVSTPKP
LSKLLGSMDEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYVHSVRDPVHNRVTLELS
NGSMVRITIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYHSEWNLF
VTCLMNLMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSDTGSDDDWEYLLNSDYHQNVE
SHLLSRSLCLGPLEVSQMKDEDFSQNLSLDSSTLLFSHIPAIFFVLHLVYEELKLNTLMG
EGICSLVDLLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVFAIDPGQTGFMHHPSFFTTE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYILGDESSVSNDASQYLSRIT
VAPQKPQAEQEENRFTFRHSTSVSSLAEKLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEPVCLLIGRQDLSKQACEGNLPRGKSVLSSDVPSGTEAEEEDDGMNDMN
HEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQAGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS
APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRYLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISA
FTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRL
GRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWL
QAGGDMCVHAYLSGQPFEESQLSMLACFLVYHSVPAPRHLPSVALEGSTSFAELLFKFKQ
LKMPVRALLRLAPLLLGNPQPMVM
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgtcgaacttctatgaagaaaaggcaacaatgattgcagccggggatttgcaggaattt
gttcctttcggtcgagaccactgcaagcaccaccctaatgctttgaaccttcagcttcgc
caactgcagccagcctctgaattatggtcgtctgatggtgctgctggcttggtgggatcc
cttcaggaggttacaatccacgagaaacaaaaggaaagctggcagctaaggaaaggtgtc
agtgaaattggagaagaagtggactatgatgaggagctctatgtggctggaaatatggtg
atctggagcaaaggaagtaagagccaggctctggcagtttataaagcgttcacagttgac
agtcctgttcagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
acctacagtagctatgaagtagaaaaatgcatatgtatattgcaaagctcatgtattaac
atgcacagcatagaaggaaaggattacatagcttccttaccatttcaggttgcaaatgtt
tggcccactaaatatggattgttgtttgaacgaagcagttcttcacatgaggtgcctcca
ggtccacccagagaacctttacccaccatgttcagcatgctgcacccactagatgaaata
accccccttgtttgtaaatctggaggtctttttggttcgacacgggtgcattatgttgta
gatccagcaatgaaaattgttttccttaacattgacccctccatcgtaatgacctatgac
tctgttcagaatgtgcattctgtgtggactctccggagagtcaagccagaggaagagaat
gctgttttaaagttctctgagcaggggggaaccccacagaacgcggccaccagcagctcc
ctcacagcacatctcagaagcctctccaaaggagattctcccgtggcttcccctttccag
aattactcctccattcacagccagagccgttcagcctcatcacccagcctgcattcccgc
tcaccttcgatttccaacatggcagctctcagtcgtgcccattctcctgccttaggagtg
cattctttttcaggagtgcaaaggttcaatgtttcaagccataatcagtctccaaagaga
cacagtatttctcattctccaaccagcaattccaatggctcctttcttgcaccagaaaca
gagccaattgttcctgagctgtgtattgaccatttgtggacagaaacgatcactaatata
agggagaaaagttcacaagcctcaaaagtgtttattacaactgatctgtgtggacaaaag
ttcttgtgctttttagtagagtctcagctccagttacgctgtgtgaagttccaagagagt
aatgataaaacccagctcatctttggctctgtcaccaatatacatgcaaaagatgcagca
ccagtggagaagatagataccatgctggtcttggaaggcagtggaaacttggtgctgtat
acaggagtggttcgggtgggaaaggttttcattcctggactgccagctccttccctgaca
atgtccaacacgatgcctcggcccagtactcctcttgatggtgttagtactcctaaacct
ctcagtaaactgcttggatcgatggatgaggttgttttgttgtctccggttccagaactg
agggattcttcaaaactccacgattctctctataacgaggactgtactttccaacagctt
ggcacttacgttcattctgtcagagatcctgtccataacagagtgactttagaactaagt
aatggctccatggttaggatcactattccggaaattgccacgtctgaattagtacaaact
tgtctgcaagcaattaagtttatcctgccaaaagaaatagcggttcagatgcttgttaag
tggtacaatgtccacagtgctccaggaggacccagttatcactcagagtggaatttgttt
gtaacttgtctcatgaacttgatgggttataacacagaccgcttagcttggacccgaaat
tttgattttgaagggtctctttctccagtcattgcgcccaaaaaagcaaggccttcggat
actggatctgatgatgactgggaatatttactaaattcggactaccaccagaatgtcgag
tctcatcttttgagcaggtctctgtgtttgggtcctttggaggtttcacagatgaaggat
gaggatttttcacagaacctcagtctggattcttctacacttctctttagtcacatacct
gcaattttctttgttcttcaccttgtctatgaggagcttaagttgaatactctgatggga
gaaggaatttgctcgcttgttgacctccttgttcagttggccagagacttaaaattggga
ccttacgtagatcattactatagagactatccaacgctcgtcagaactactggacaagtg
ttcgcaattgatccaggtcaaacaggatttatgcatcatccgtcattttttacaactgag
ccaccaagtatttatcagtgggtgagttcttgtctgaagggtgaaggaatgccaccttat
ccttacctccctggaatctgtgaaagaagcagactggtggttttgagtattgcactctac
atacttggtgatgagagctcggtttctaatgacgcctcacaatatttatccagaataact
gtagccccccagaaaccacaagcagaacaagaggaaaacaggtttactttcaggcattct
acatcagtttctagcctagcagaaaaattagttgtctggatgacaaatgtaggattcact
ttaagagatttggaaacacttccctttggaattgcccttcctatcagagatgcaatttat
cactgtcgtgagcagcctgcttcagattggccagaacctgtctgcctcttaattggacgt
caagatctttctaagcaagcttgtgaaggaaacttacctagagggaaatctgtactctca
tcagatgttccttcaggaacagaagctgaggaagaagacgatggcatgaatgacatgaat
catgaggttatgtcattaatttggagtgaagatttaagggtgcaggatgtacgaaggctt
cttcaaagcgcacatcctgttcgtgtcaatgtagtgcaatacccggaactcagtgaccat
gagttcattgaagaaaaagaaaacagattgctccaattgtgtcagcgaaccatggccctt
ccagtaggacgagggatgtttaccttgttttcataccatcctgttccaacagaacccctt
cctattcctaaattgaatctcaccgggcgtgcccctcctcggaatacaacagtggacctt
aatagtggaaacatcgatgtgcctcccaacatgacaagctgggccagctttcataatggt
gtggctgctggcctgaagatagcccctgcctcccagatcgactcagcttggattgtttac
aataagcccaagcatgcagagttagccaatgagtatgcaggctttctcatggccctgggt
ctgaatgggcaccttaccaagctggctactctgaatatccatgactacttgaccaagggc
catgaaatgacaagcattggacttctgcttggtgtttctgctgcaaaactaggcaccatg
gatatgtcaattactcggcttctcagcattcacattcctgctctcttacccccaacgtcc
acagaacttgatgttcctcacaatgttcaagtggctgcagtggttggcattggccttgta
tatcaagggacagctcatagacatacagcagaagtcttactggctgaaataggacgcccc
cctggccctgaaatggagtactgtaccgacagagagtcatactctttagctgctggcctg
gccctgggcatggtttgcttggggcacggcagtaacctgatagggatgtctgacctcaat
gtgcctgagcagctttatcagtacatggttggaggtcacaggcgctttcaagcagggatg
cacagggagaaacataaatctccaagttaccaaatcaaggaaggagataccataaatgtg
gatgtgacttgtccaggtgctactctagctttggctatgatctatttaaaaactaataac
agatccattgcagattggcttcgggctcctgataccatgtatttgctggactttgtgaaa
ccagagtttctgttgcttaggacacttgctcgatgcctgattttgtgggatgatatttta
ccaaattccaagtgggttgacagcaatgttcctcagattataagagaaaatagtatctct
ctcagtgaaattgaattgccttgctcagaggacttgaatttagaaactttatcgcaagca
catgtctacataattgcaggagcctgcttgtctctgggttttcggtttgccggctcagaa
aatttatcagcatttaactgcctgcataaatttgcaaaagatttcatgacctatctgtct
gcacctaatgcttctgtaacaggcccgtacaacttggagacttgcctgagtgtggtattg
ctgtctcttgccatggtaatggctggctcggggaacctgaaggtgttgcagctttgccgc
tacttgcacatgaaaacaggtggtgaaatgaactatggctttcacctagcccaccacatg
gccctggggcttctgtttttgggaggaggaaggtactccttgagcacatcaaactcttcc
attgctgctctcctctgtgccctttacccgcacttcccagcccacagcactgacaaccgg
tatcatctccaggctctccggcatctctatgtgctggctgcagaaccgaggcttctggtg
ccagtggatgtggacaccaacactccctgctatgccctcttggaggttacctacaagggc
actcagtggtatgaacaaaccaaagaagaattgatggctcctacccttcttccagaactc
caccttttaaaacagattaaagttaaaggcccaaggtactgggaactgcttatagatttg
agcaagggaacacaacacttgaagtccatcctttccaaggatggggttttatatgttaag
ctcagggcgggtcagctctcctacaaggaagatccgatggggtggcaaagtttgttggcc
cagactgttgccaataggaactctgaagctcgggctttcaagccagaaacaatttcagca
ttcacttctgatccagctcttctgtcatttgctgaatacttctgcaagccaactgtgaat
atgggtcagaaacaggaaattctggatctcttttcttcagtgctctatgaatgtgtgact
caggagactccagagatgctccctgcctacatagcaatggaccaggctataagacgactt
ggaagaagagaaatgtctgagacatctgaactttggcagatcaagttagtgttggagttt
ttcagctcacgaagccatcaggagcggctgcagaaccaccctaagcgcgggctctttatg
aactctgaattcctgcctgttgtgaagtgcaccattgataacaccctggaccagtggctc
caagccgggggtgacatgtgtgtgcacgcctacctcagtgggcagcccttcgaggaatct
cagctgagcatgctggcctgcttcctcgtctaccactcggtgcctgctccgcgccacctg
ccgtctgtggcactagaaggaagcacaagctttgccgaactgctcttcaagtttaaacag
ctgaaaatgccggtgcgagctttgctgcgattggctcctttgctgcttggaaacccacag
ccaatggttatgtga

KEGG   Oryctolagus cuniculus (rabbit): 100350229
Entry
100350229         CDS       T03373                                 
Symbol
ANAPC4
Name
(RefSeq) anaphase promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100350229 (ANAPC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100350229 (ANAPC4)
   04114 Oocyte meiosis
    100350229 (ANAPC4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100350229 (ANAPC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100350229 (ANAPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350229 (ANAPC4)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100350229 (ANAPC4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100350229 (ANAPC4)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100350229 (ANAPC4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 100350229
NCBI-ProteinID: XP_008272966
Ensembl: ENSOCUG00000016004
UniProt: G1TAQ4
LinkDB
Position
2:15899405..15945571
AA seq 809 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKVVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSAGGAAEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDATGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKVMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVEKVGQYL
KDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQK
PADVIGKSMNQAICIPLYRDARSEDCARRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMC
ILRRHTDISQSVSNGLIAVKFGSFTYATTEKIRRSTYSCLDAQFYDDETVTVVLKDTVGR
EGRDRLLVQLPLSLVYNSEDSAEYQFTGSYSVRLDEQCGVIPTRTVHFEKHWRLLESMKA
QYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDDEEEAGSKPVRIKEEVLSEA
EAESQQAGAAALAPDVVIKVEELDPELDA
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgttgcgctttccgacctgtttcccatccttccgggtggtgggagagaagcagctgccg
caggagatcattttcctggtctggtcgcccaagcgggacctcattgctttggccaacaca
gcgggcgaggttttgcttcaccgacttgcaagttttcatcgagtttggagttttccacca
aatgaaaacacaggaaaggaagtgacctgtctggcttggagaccagatggcaaacttttg
gcctttgctcttgctgacaccaagaaagttgttttgtgtgatgtagagaaacctgagagc
ttgcactctttttctgtggaggctcctgtttcttgcatgcattggatggaagtgactgtg
gaaagcagtgttctgacatctttttataatgctgaagatgagtcaaatcttctgttacct
aaactgcctacattgccaaaaaactacagcaacacctcaaaaatatttagtgaagaaaat
tccgatgaaattattaagctcttgggagatgtcaggcttaatattcttgtccttggagga
agctctggctttattgaactgtatgcttatggcatgttcaagatcgcccgagtcacgggg
attgctggcacctgtctcgcgttgtgtttgtccagtgatctgaagtcactatcagtggtc
acagaggtgtctgccggtggggctgcagaggtctcttacttccagcttgaaaccaacctg
ttatactctttcttacctgaagtaactcgcatggccagaaagtttacacacatttcagct
cttttacagtatataaatttgtcgctgacgtgtatgtgtgaagcatgggaagagatcctc
atgcagatggattctcgtctcactaagtttgtgcaggaaaagaacacgaccacatcagtg
caggatgaattcatgcacctgctgctgtgggggaaagcaagtgctgaactgcagactctc
ttaatgaaccagttaacagtaaagggcttaaaaaagcttggccagtctatcgaatcatca
tattccagtatacaaaagttggttataagtcacttacagagtggctctgagtctttgctg
taccatttgagtgagttgaaaggaatggcttcgtggaaacaaaaatacgagcccctggga
ctggatgccacaggcatcgaagatgctattaccgctgtgggttccttcatactcaaggcc
aatgaacttcttcaagttatcgatagtagtatgaaaaacttcaaagcattttttcggtgg
ctgtatgtagcaatgctgagaatgacagaagaccacgtgcttcccgagctgaataaggtg
atgactcaaaaagatattacatttgttgctgaatttcttactgaacatttcaatgaggct
cctgacctttataatcgcaaaggaaaatactttaacgttgaaaaagttggtcagtacctg
aaagacgaagatgacgatctcgtgtcgccccctaacacggaaggaaaccagtggtatgac
tttcttcaaaacagcagccaccttaaagaaagtcctttgctgtttccttattaccctcga
aaatcattgcattttgtgaaaaggcgcatggagaacatcattgaccagtgtttgcaaaag
ccagctgacgtaattggaaaatcaatgaatcaagccatctgcatcccattatacagagat
gctaggagtgaggattgtgctcgtagattgttcaaattcccttttctgtggaataataaa
acttcaaatctgcattatcttctttttactattttagaagattcactttataaaatgtgc
atcttaaggagacatactgatatttcccaatctgtaagtaatggactgattgctgttaag
tttgggagcttcacgtatgccacaactgaaaaaatcaggagaagcacctacagctgttta
gatgcgcagttttatgatgatgaaactgttacggtggttcttaaagacacagtaggacgg
gagggaagagacagactcttggtccagctgccattgtctttagtatacaacagcgaagat
tctgccgaataccagttcactgggagttactctgtaaggctggacgagcagtgcggcgtc
atccccacgcgcactgtgcatttcgagaagcactggcggttactggaaagcatgaaagca
cagtacgtcgctgggaatggtttccggaaagtgtcctgcgtgttaagctcgaacctgcgc
cacgtgagagtgtttgaaatggacatcgatgacgagtgggagctggatgagtcttcggac
gacgaggaggaggcgggcagcaagcctgtgaggataaaggaggaggtgctgtctgaggcc
gaggccgagagccagcaggctggcgccgccgcgctggctcccgacgtcgtcatcaaagtg
gaagagctggaccccgagctggacgcgtag

KEGG   Oryctolagus cuniculus (rabbit): 100350286
Entry
100350286         CDS       T03373                                 
Symbol
ANAPC5
Name
(RefSeq) anaphase promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04657  IL-17 signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100350286 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100350286 (ANAPC5)
   04114 Oocyte meiosis
    100350286 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100350286 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100350286 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100350286 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350286 (ANAPC5)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100350286 (ANAPC5)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100350286 (ANAPC5)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100350286 (ANAPC5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_2 TPR_10 TPR_7 MapZ_EC1
Other DBs
NCBI-GeneID: 100350286
NCBI-ProteinID: XP_002719785
Ensembl: ENSOCUG00000002722
UniProt: G1SI60
LinkDB
Position
21:6242963..6286116
AA seq 755 aa
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEDSCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQSGEKKTVEDADMELTGR
EDGERKMEKEDLDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAEGKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRADSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLESVHSGVQQNNTESFAVALCHLAELHAEQ
GCFAAAAEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
MEGVYRKAVVLQAQNQMSEAHKLLQKLLSHCEKLKNTEMVISVLLSVAELYWRSSCPTIA
MPVLLHALALSKEYRLQYLASETVLNLAFAQLILGIPEQALTLLHMAIEPVLADGAILDK
GRAMFLVAKCQVASAASCDPPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVLYFQARL
YHMLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggccagcgtccacgaaagcctctacttcaatccaatgatgaccaacggggtggtgcac
gcgaacgtgttcggcatcaaggactgggtgacgccatataagatcgccgtgctggtgctg
ttgaacgagatggggcgcacgggcgagggcgccgtgagcctcatggagcggcggaggctc
aaccagctgctcctgccgctgctgcagggcccagatatcacgctgtcaaaactgtacaag
ttgattgaagactcttgtcctcagctggcaaattcagtacagatcagaatcaaactgatg
gctgaaggcgaattgaaggatatggagcaattttttgatgacctttcagattctttttct
ggaactgagccagaggttcacaaaacaagtgtagtaggtttgtttctgcgtcacatgatc
ctggcctacagtaagctttctttcagccaagtgtttaaactgtacactgcccttcaacag
tatttccaaagtggtgagaaaaaaaccgtggaggatgctgatatggaactgaccggtaga
gaagacggagaaagaaaaatggaaaaagaagacctggacgtctctgtgagagaagaggaa
gtatcttgcagtgggcctctatcccaaaagcaagcagagttttttctttctcagcaggct
tctttattaaagaatgatgaaactaaagcccttactccagcttccctgcagaaggaattg
aacaacttgttgaaatttaatccggattttgctgaagcgcactacctcagctacttgaac
aacctccgcgtccaggatgttttcagttcgacacacagcctgctgcattattttgaccgc
ctgatactcactggagccgagggcaaaagcaacggggaagagggctacgggcggagcctg
cgatacgccgccctgaacctggctgccctccactgccgcttcggtcactatcaacaggca
gagctcgccctgcaggaggcaattaggattgcccaggagtccaacgatcacgtgtgtctc
cagcactgtttgagctggctttatgtgctggggcagaagagagccgatagctatgtcctg
ctggagcactcggtgaagaaagcagtgcattttgggttaccgtacctcgcctccctggga
atacagtcccttgttcaacagagagcttttgctgggaagacggccaacaagctgatggac
gccctcaaggactccgacctcctgcactggaagcacagcctgtcggagctcatcgacatc
agcatagcccagaaaacggccatctggaggctgtacgggcgcagcaccatggcgctgcag
caagcccagatgttgctgagcatgaacagcctggagtcggtgcattcgggcgtgcagcag
aacaacacagagtcgtttgccgtcgcactctgccaccttgcagagctacacgcggagcag
ggctgttttgctgcagctgctgaagtgttgaagcacctgaaggagcgatttccgcccaac
agtcagcacgcccagttatggatgctgtgtgatcagaaaatacagtttgacagagcgatg
aatgatggcaaataccatttggctgattcactagttacaggaatcacagctcttaacagc
atggagggtgtgtatagaaaagcagttgtactacaggctcagaaccagatgtcagaggca
cacaagcttttacaaaaattgctgagtcattgtgagaaactgaagaacacagaaatggtg
attagcgtcctgctgtcggtggcagagctgtactggcgatcttcctgccctaccatcgcg
atgcccgtgctcctgcacgctctggccctctccaaggagtaccgcttacagtacttggcc
tcggaaacggtgctgaacttggcttttgcccagctcatcctcggaatcccggaacaggcc
ttaaccctcctgcacatggccatcgagcccgtcctggcggacggggccatcctggacaaa
ggccgcgccatgttcctcgtggccaagtgccaggtggcttcagcagcttcctgtgatccc
ccgaagaaagccgaagctctggaggctgccatcgagaacctcaatgaagccaagaactac
tttgcaaaggtcgactgcaaagagcgcatccgagacgtcctttacttccaggccaggctc
taccacatgctggggaagacgcaggagaggaaccggtgcgcgatgctcttccggcagctg
catcaggagctgccctctcacggcgtgcccttgatcaaccacctctag

KEGG   Oryctolagus cuniculus (rabbit): 100352519
Entry
100352519         CDS       T03373                                 
Symbol
ANAPC13
Name
(RefSeq) anaphase promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100352519 (ANAPC13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100352519 (ANAPC13)
   04114 Oocyte meiosis
    100352519 (ANAPC13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100352519 (ANAPC13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352519 (ANAPC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100352519 (ANAPC13)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100352519 (ANAPC13)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100352519 (ANAPC13)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100352519 (ANAPC13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 100352519
NCBI-ProteinID: XP_002716344
LinkDB
Position
14:complement(28403993..28411282)
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPVGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaggtgcagcgggatggaaggatcttggatctcatcgacgacgcttggcgg
gaagacaagctgccttacgaggatgtggcgataccgctgaacgagctgcctgaacccgag
caggacaacggcggcaccacggagtctgtcaaagaacaagaaatgaagtggacagacctg
gccctgcagtacctgcacgagaacgtgccccccgtcgggaactga

DBGET integrated database retrieval system