KEGG   Oryctolagus cuniculus (rabbit): 100342168
Entry
100342168         CDS       T03373                                 
Symbol
KLHL9
Name
(RefSeq) kelch like family member 9
  KO
K10447  kelch-like protein 9/13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342168 (KLHL9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342168 (KLHL9)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100342168 (KLHL9)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_3 Kelch_2 Kelch_4 Kelch_5
Other DBs
NCBI-GeneID: 100342168
NCBI-ProteinID: XP_008252255
Ensembl: ENSOCUG00000008548
UniProt: G1SVD4
LinkDB
Position
1:complement(32391475..32395602)
AA seq 617 aa
MKVSLGNGEMGVSAHLQPCKTGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGD
EIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFIYTAKLSLNMD
NLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKN
FPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAACRWLRLEDPRMDYAAKLMKNI
RFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHL
VTLGGVLRQQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDT
KGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYN
PRMNEWSYVAKMSEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMT
TVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGV
AVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEEN
PGSPSRESPLSAPSDHS
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgaaagtgtctctcggtaacggcgaaatgggcgtctctgcccatctgcaaccttgcaag
acgggaaccacacggttttttaccagcaatactcacagttcggtggtactgcaaggcttt
gatcagcttagaatagaaggtttgctttgtgatgtgaccctggtaccgggcgatggagat
gaaatcttccctgttcacagagcgatgatggcttctgctagtgattatttcaaggctatg
ttcacaggtggaatgaaagagcaagatttaatgtgcattaagcttcatggggtgaacaag
gttggtctgaagaaaatcattgattttatttatactgcaaaactttctcttaacatggac
aatcttcaggacactcttgaagctgctagcttcttacaaatcttacccgttttggatttc
tgtaaagtatttcttatatcaggagtctctttggataactgcgttgaggttggacgaatt
gctaacacctacaatctaatagaagtggataaatatgttaataatttcatcttgaagaac
ttccctgctttactgagtactggagagtttctaaaactcccttttgaacggcttgccttt
gtgctttccagtaatagtctaaagcactgtactgaacttgaactattcaaggctgcctgt
cgatggctaaggttggaagatcctcggatggattatgctgcaaaattaatgaagaatatt
cgatttccactgatgacaccacaggacctcatcaattatgtgcagaccgtggatttcatg
agaacagacaatacctgtgtgaacttgcttttggaagctagcaactaccaaatgatgcca
tatatgcagccagtgatgcagtctgacagaactgccattcggtctgactctacgcacttg
gttaccttagggggagtgttgaggcaacagctggttgtcagtaaagaattaaggatgtat
gatgaaagagcacaagagtggagatctttagcccccatggatgctcctcgttaccagcat
ggcattgctgtcattggaaacttcctttatgtggttggtggtcaaagtaattatgataca
aaaggaaaaactgctgtcgatacagtttttagatttgatcctcgatataataaatggatg
caagttgcatcattaaatgaaaagcgcactttcttccacttgagtgctctcaaaggacat
ttgtatgcagttggagggcgcagtgcagctggtgaactggccacagtagaatgttacaac
ccacgaatgaatgagtggagctatgttgcaaaaatgagtgaaccccattatggccatgct
ggaacagtgtatggaggcttaatgtatatttcaggaggaattacccatgacactttccaa
aatgagctcatgtgttttgacccggatacagacaaatggacacagaaggccccaatgact
acagtcagaggattgcattgcatgtgtacagttggagataagctctatgtcatcggtggc
aatcacttcagaggaacaagtgattatgatgatgttctaagctgtgaatactattcacca
acgcttgaccagtggacaccaattgctgccatgttaagaggtcaaagtgatgttggagtt
gctgtctttgaaaataaaatctacgttgttggtggatattcttggaataatcgttgtatg
gtagaaattgtccagaaatatgatccagaaaaagatgagtggcataaagtttttgacctt
ccagagtcactcggtggcatccgagcttgtaccctcacggtttttccccctgaagaaaac
cctggatcaccttctagagagtcgccactctcagcaccttcagatcattcttag

KEGG   Oryctolagus cuniculus (rabbit): 100345646
Entry
100345646         CDS       T03373                                 
Symbol
RHOBTB2
Name
(RefSeq) Rho related BTB domain containing 2
  KO
K07868  Rho-related BTB domain-containing protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100345646 (RHOBTB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345646 (RHOBTB2)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100345646 (RHOBTB2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100345646 (RHOBTB2)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoBTB
    100345646 (RHOBTB2)
SSDB
Motif
Pfam: BTB Ras Roc zf-RING_4
Other DBs
NCBI-GeneID: 100345646
NCBI-ProteinID: XP_008249966
Ensembl: ENSOCUG00000017452
UniProt: G1TTZ9
LinkDB
Position
Un
AA seq 749 aa
MEARRKGWDSPWTTSLDSTSQLMDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNA
TLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYG
RSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRP
LARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALISRRHLQFWK
SHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRI
FAHKIYLSTSSSKFYDLFLMDLSEGELGGPSGPGGPRPEDPRGHPEPHHHHHHHHHGRDF
LLRAASFDVCESVDEAGGSGPGGLRASTSDGILRGNGTEYLPGRGRVLSSWSRAFVSIQE
EMAEDPLTFKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELGENERDLLHIAHIAELLEVF
DLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLL
ISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSTPDLDDMKLIILA
NRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTN
YNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPK
RRWLFWNSPASPPASAATSASPSSSSAVV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggaagcccgaaggaaaggctgggacagcccttggacgacctctctggacagcacgtcc
caattaatggattctgacatggattatgaaaggccaaacgtagagaccatcaagtgcgtg
gtggtgggcgacaacgccgtgggcaagaccaggctcatctgtgcccgggcctgcaatgcc
accctcacccagtaccagctgctcgccacccacgtgcccaccgtttgggccatcgaccag
taccgcgtgtgccaggaggtgctggaacgctcccgagacgtggtagatgacgtcagcgtc
tccttgcgcctctgggacacctttggagaccaccacaaagaccgccgctttgcgtatggg
agatccgacgtggtggttctgtgcttctccatcgccaaccccaactccctccaccatgtc
aagaccatgtggtacccagaaatcaagcacttctgccctcgggcacctgtcatcctggtg
ggctgccagctggacctgcgctacgccgacctggaggccgtcaacagggcccggcgaccc
ctggccaggcccatcaagcccaatgagatcctccccccggagaaggggcgggaggtggcc
aaggagctgggcatcccctactacgagaccagcgtggtggcccagtttggcatcaaggac
gtctttgacaacgccatccgggccgcgctcatctcgcgccgccacctgcagttctggaag
tcccacctccgcaacgtgcagcggcctctgctgcaggcgcccttcctgccccccaagccg
ccgccccccatcatcgtggtgcccgaccccccgtccagcagcgaggagtgccccgcccac
ctcctggaggacccgctctgcgcggacgtcatcctggtgctgcaggagcgagtgcgcatc
tttgcccacaagatctacctctccacctcctcctccaagttctacgacctgttcctcatg
gacctgagtgagggggagctggggggcccctcagggccaggcggcccccgcccggaggac
ccccggggccaccccgagccacaccaccaccaccaccaccaccaccacgggcgggacttc
ctgctgcgggcagccagctttgacgtgtgtgagagcgtggacgaggccgggggctcgggt
cctggcggcctgcgggcctccaccagcgacgggatcttacggggcaacgggacagagtac
ctgccgggcaggggtcgcgtgctgtcctcctggagccgggctttcgtgagcatccaggag
gagatggcagaagaccctctgaccttcaagtcgcggctgatggtggtggtgaagatggac
agctccatccagccggggcccttccgggccgtcctcaagtacctgtacaccggggagctg
ggcgagaacgagcgggacctcctgcacatcgcccacatcgccgagctgctggaggtcttc
gatctgcgcatgatggtggccaacatcctcaacaacgaggccttcatgaaccaggagatc
accaaggccttccacgtgcgccgcaccaaccgggtcaaggagtgcttggccaagggcacc
ttctcagacgtgaccttcatcctggacgacggcaccatcagcgcccacaagcccctgttg
atctccagctgtgactggatggctgccatgttcgggggcccgttcgtggagagttccacc
agggaggtggtgtttccctacaccagcaagagctgcatgcgggcggtgctggaatacctg
tacacgggcatgttcacgtccacccccgacctggacgacatgaagctcatcatcctggcc
aaccgcctctgcctgccgcacttggtcgccctcacagagcagtacaccgtgaccgggctg
atggaagccacccagatgatggtggacatcgatggagacgtcctggtgttcctggagctg
gctcagttccattgcgcctaccagctggccgactggtgcctgcaccacatctgcaccaac
tacaacaacgtgtgccgcaagttcccccgcgacatgaaggccatgtccccagaaaaccag
gagtacttcgagaagcaccggtggcctccagtgtggtacctgaaggaggaggaccactac
cagcgggcccggaaggagcgggagaaggaggactacctccacctgaaacggcagcccaag
cggcgctggctgttctggaacagccccgcctcgccgcccgcctctgccgccacctctgcg
tcgccctcctcctcctcggctgtggtctga

KEGG   Oryctolagus cuniculus (rabbit): 100346935
Entry
100346935         CDS       T03373                                 
Symbol
KEAP1
Name
(RefSeq) kelch like ECH associated protein 1
  KO
K10456  kelch-like protein 19
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05012  Parkinson disease
ocu05200  Pathways in cancer
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05225  Hepatocellular carcinoma
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100346935 (KEAP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346935 (KEAP1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100346935 (KEAP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100346935 (KEAP1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100346935 (KEAP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100346935 (KEAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100346935 (KEAP1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100346935 (KEAP1)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 Kelch_2 BTB Kelch_4 Kelch_5
Other DBs
NCBI-GeneID: 100346935
NCBI-ProteinID: XP_002723322
Ensembl: ENSOCUG00000001435
UniProt: G1SFF4
LinkDB
Position
Un
AA seq 624 aa
MQPEAEPSGAEACSRFLPQQSQRPEGAGDAMMFASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYEDTPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPQVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCAELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPHFLQMQLQKCEILQSDSRCKDY
LVKIFQELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGV
IDGHIYAVGGSHGCLHHNSVERYEPERDEWHLVSPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSVECYYPERNEWRMITPMNTIRSGAGVCVLHSCIYAAGGYDGQDQLNSVERYDVE
TETWSFVAPMKHRRSALGVTVHQGKIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgcagccggaagccgagcctagcggggcggaggcctgcagccgattcctgccccagcag
tcacagcgccccgagggggcgggggacgccatgatgttcgcctccaccgagtgcaaggcc
gaggtgacgccctcccagcatggcaaccgcaccttcagctacacgctggaggaccacacc
aagcaggccttcgggatcatgaatgagctgcggctcagccagcagctgtgtgacgtcacg
ctgcaggtcaagtacgaggacacgccggccgcccagttcatggcccacaaggtggtgctg
gcctcgtccagcccggtcttcaaggccatgttcaccaacgggctgcgggagcagggcatg
gaggtggtgtccatcgagggcatccacccccaggtcatggagcggctcattgagttcgcc
tacacggcgtccatctccatgggcgagaagtgcgtgctgcacgtcatgaacggtgccgtc
atgtaccagatcgacagcgtcgtccgcgcctgcagcgacttcctggtgcagcagctggac
cccagcaacgccatcggcatcgccaacttcgccgagcagatcggctgcgccgagctgcac
cagcgcgcccgcgagtacatctacatgcacttcggggaggtggccaagcaggaggagttc
ttcaacctgtcccactgccagctggtgaccctcatcagccgcgacgacctgaacgtgcgc
tgcgagtccgaggtcttccacgcctgcatcaactgggtcaagtacgactgcgagcagcgg
cgcttctacgtgcaggcgctgctgcgcgccgtgcgctgccactcgctcacgccgcacttc
ctgcagatgcagctgcagaagtgcgagatcctgcagtcggactcccgctgcaaggactac
ctggtgaagatcttccaggagctcaccctgcacaagcccacgcaggtgatgccctgccgc
gcgcccaaggtgggccggctcatctacacggccggcggctacttccgccagtccctcagc
tacctggaggcctacaacccgagcgacggcacctggctgcggctggcggacttgcaggtg
ccgcggagcggcctggcgggctgcgtggtgggcgggctgctctacgccgtgggcggccgg
aacaactcccccgacggcaacaccgactccagcgccctggactgctacaaccccatgacc
aaccagtggtcgccctgcgcctccatgagcgtgccccgcaaccgcatcggggtcggggtc
attgacgggcacatctacgcggtgggtggctcccacggctgcctccaccacaacagcgtg
gagaggtacgagccggagcgggacgagtggcacctggtgtccccgatgctgacccgaagg
atcggggtgggcgtggccgtcctcaaccgcctgctctatgccgtcgggggctttgacggg
acgaaccgccttaactcggtcgagtgctactacccggagaggaacgagtggcggatgatc
acccccatgaacaccatccgaagcggggcaggggtctgcgtgctgcacagctgcatctac
gcagcggggggctacgatgggcaggaccagctcaacagcgtggagcgctacgacgtggag
acggaaacctggagcttcgtagcccccatgaagcatcggcggagcgcgctgggggtcact
gtgcaccagggaaaaatctacgtcctcggaggctacgacgggcacacgttcctggacagc
gtggagtgctacgacccagacactgacacctggagcgaggtgacccgcatgacgtccggc
cggagcggcgtgggcgtcgccgtcaccatggaaccctgccggaagcagatcgaccaacag
aactgcacctgttga

KEGG   Oryctolagus cuniculus (rabbit): 100349700
Entry
100349700         CDS       T03373                                 
Symbol
KLHL13
Name
(RefSeq) kelch like family member 13
  KO
K10447  kelch-like protein 9/13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100349700 (KLHL13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100349700 (KLHL13)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100349700 (KLHL13)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 BTB Kelch_2 Kelch_4 Kelch_5
Other DBs
NCBI-GeneID: 100349700
NCBI-ProteinID: XP_002720292
Ensembl: ENSOCUG00000001993
UniProt: A0A5F9CFB7
LinkDB
Position
X:complement(66534202..66723519)
AA seq 658 aa
MMRVQTLREKWAYWRRRQLSLKQADFKDIFKKSTSGSLVEEEDQHMKLSLGSSEMGLSSH
LQSSKAGTTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASD
YFKAMFTGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQIL
PVLDFCKVFLISGITLDNCVEVGRIANTYNLTEVDKYINSFVLKNFPALLSTGEFLKLPF
ERLAFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQ
TVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSK
ELRMYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPR
YNKWMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEP
HYGHAGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERL
YVIGGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSW
NNRCMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgatgagagttcaaaccttaagagaaaaatgggcttattggagacggaggcagttgtct
ttaaaacaagccgatttcaaggatatattcaaaaaatcaacttcaggatctctcgtggaa
gaggaagaccaacacatgaaattgtcccttggaagcagcgaaatgggcctctcatcccat
ttgcagtcttccaaggcaggaaccacacgcatctttaccagcaatacccacagttctgtg
gtattacagggctttgaccagctgcggcttgaaggattgctttgtgatgtgaccctgatg
ccaggtgacacagatgatgccttccctgtgcatagagttatgatggcatctgctagtgat
tacttcaaggctatgttcacaggtggaatgaaagaacaagatttaatgtgcattaagctt
catggtgtgagcaaagtcggtctaaggaaaattattgatttcatttatactgcaaaactt
tctcttaatatggacaaccttcaagacacactggaagctgctagctttctacagattctg
ccagttttggacttctgtaaagtatttctcatttctgggattactttagacaattgtgtc
gaagttgggcggattgccaacacctacaatctgacagaagtggataaatatatcaacagt
tttgtcttgaagaattttcctgcattgctgagtactggggagttcttgaaactccccttt
gagcgtcttgcctttgtgctttccagtaacagccttaagcattgcactgaacttgagctc
tttaaggctacctgtcgctggcttcgcctggaagagcctcggatggactttgctgcgaaa
ttgatgaagaacatacgatttccactgatgacaccacaggagctcattaattacgtgcaa
acagtagatttcatgagaactgacaatacttgtgtgaatttgcttttggaagccagcaat
taccaaatgatgccatatatgcagccagtgatgcagtcagacaggactgccattcggtct
gacaccactcatttggttacactaggaggagtgctgagacagcagctggttgtcagtaag
gagctgcgcatgtatgatgaaaaggcccacgagtggaaatccttggcgcccatggatgcc
ccaaggtaccagcatggcatcgccgtcattggaaatttcctctatgtcgttggtggacag
agcaattatgacacaaaaggaaaaacagcagttgatacagtcttcagatttgatccccga
tacaacaaatggatgcaagttgcctcactaaatgaaaagcgcaccttcttccacctaagt
gccctcaaaggatatctgtatgcagtcggtggacgcaatgcagctggtgaactgcctaca
gtagaatgttacaatccaagaacaaacgagtggacctatgttgccaaaatgagtgagccc
cactatggccatgctggaactgtatatggaggagtgatgtatatttcaggaggaattact
catgatactttccaaaaggagctcatgtgctttgaccctgatactgacaaatggatccag
aaggcgccaatgaccactgtgcgaggtctgcattgtatgtgtacagtgggagaaaggctc
tatgtcattggcggcaatcacttcagaggaaccagtgattacgatgatgtcctaagctgt
gaatactattcacctatccttgatcagtggaccccaattgctgccatgttaagagggcag
agtgatgttggggtcgctgtctttgaaaataaaatatatgtggttggtgggtactcttgg
aataaccgttgtatggtagagatagtgcagaaatatgatcccgataaagatgaatggcat
aaggtttttgatctcccagagtccctgggtggcattcgagcttgcacacttacagttttt
ccacctgaggaaaccacaccatcaccttctagagagtctcctctttctgcaccttaa

KEGG   Oryctolagus cuniculus (rabbit): 100352605
Entry
100352605         CDS       T03373                                 
Symbol
RHOBTB1
Name
(RefSeq) Rho related BTB domain containing 1
  KO
K07868  Rho-related BTB domain-containing protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100352605 (RHOBTB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100352605 (RHOBTB1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100352605 (RHOBTB1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100352605 (RHOBTB1)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoBTB
    100352605 (RHOBTB1)
SSDB
Motif
Pfam: BTB Ras Roc
Other DBs
NCBI-GeneID: 100352605
NCBI-ProteinID: XP_008268322
Ensembl: ENSOCUG00000011533
UniProt: G1T1G6
LinkDB
Position
18:25240606..25310705
AA seq 696 aa
MDTDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKT
MWYQEIKHFCPRTPVVLVGCQLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKE
LGIPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKAPP
PVIKIPECPSTGMNEAACLLDSPLCADVLFILQDQEHIFAHRIYLATSSSKFYDLFLMEC
EEFPNWGEGVCEKEKQSTDFQGRTLSPDLDGEREEGLPRTPQADQGKSSQKFLLEATGPE
AEGSTPETQTLAGWSKGFIDMHKEMQVNPISKRVGPVTVVRMDSSVQPGPFRTLLQFLYT
GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLS
KGTFSDVTFKLDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKMSMQAVL
DYLYTKQLSPNLDLDPLELIALANRFCLPHLVALAEQHAVQELTKAAMSGVGIDGEVLSY
LELAQFHNAHQLAAWCLHHICTNYNSVCSKFRKEIKSKSADNQEYFERHRWPPVWYLKEE
DHYQRVKREREKEDIALNKHHSRRKWCFWNSSPAVA
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggacactgacatggactacgaaagacccaacgttgaaaccatcaagtgcgttgtcgtg
ggtgacaacgcagtggggaagacacggctgatctgtgccagagcatgcaacactacgctg
acgcagtatcagctgctggccacccatgtgccaaccgtatgggccatcgaccagtaccgt
gtctgccaggaggtcttggagcgatcccgggatgttgtggacgaagtgagcgtctctctc
aggctctgggatacttttggtgatcatcacaaagacaggcgttttgcttatggcaggtcc
gatgttgtggtcctctgtttttcgatcgctaaccccaattccctaaatcatgtgaaaacc
atgtggtatcaagaaatcaagcacttttgccctcgtacacctgttgtcctagttggctgc
cagctcgacctccgctatgccgatcttgaagctgtgaatcgagccagacgccctttagca
aggcccataaagagaggggatattctgcccccagaaaaagggcgagaggttgcaaaggaa
cttggcataccatactatgaaacaagtgtatttgaccaattcggaatcaaggatgtgttt
gacaatgcaatacgagccgcgctgatttctcgccgccacctgcagttctggaaatctcac
ttaaagaaagtccagaaacctttgcttcaggcccctttcctacctccaaaagcccctcca
ccggtcatcaagattccagagtgtccttccacggggatgaatgaagctgcctgtttactg
gacagtcccctgtgtgcggatgtcctgttcatcctgcaggaccaggagcacatctttgca
catcggatttacctcgctacctcttcttccaaattctacgatctttttttaatggaatgt
gaagaattccccaattggggtgaaggagtgtgtgagaaagagaagcagagcacggatttc
caggggcggactttgagtcctgacctagatggggagagggaggaaggcctgcctcggaca
ccccaggctgatcaagggaagtcgtcacagaaattcctgctggaggccacggggccggaa
gctgagggctcaactcccgagacacagactttggccggctggagtaaggggttcattgac
atgcacaaggagatgcaagtcaatcccatttcaaagcgagtgggccccgtgacggtggtc
agaatggactcctccgtccagccaggccctttccgcaccctgctccagtttctttataca
gggcaactggatgaaaaggaaaaggatttggtcggcctggctcagatcgcagaggtccta
gagatgtttgatttgaggatgatggtggaaaacatcatgaacaaggaagctttcatgaac
caagagattacaaaagctttccacgtcaggaaagccaatcggataaaagagtgtctcagc
aaggggaccttctcagatgtgacctttaagttggatgatggtgccatcagtgcccacaag
ccactgctgatctgtagctgcgagtggatggcagccatgtttggggggtcatttgtggaa
agtgccaacagtgaggtatatctcccgaacataaacaagatgtcaatgcaagcagtattg
gattatctctataccaagcagttgtcacctaacttggacctggacccactggaattaatt
gctttggcaaacagattttgcctgccacacttggttgcacttgcagagcagcacgcagtc
caggagctgaccaaggccgccatgagtggcgtgggcattgacggggaagtgctttcttat
ttggaattggcccagtttcacaacgcccaccaattggccgcttggtgtttgcaccacatc
tgcaccaactacaacagcgtttgttccaagttccgcaaggaaatcaaatcaaaatctgca
gacaaccaagaatactttgagcggcaccgctggccccctgtgtggtacctgaaggaagag
gaccactaccagcgcgtgaaaagggaacgcgagaaggaagatattgcactcaataaacat
cactcaagacgaaagtggtgcttctggaattcatctccagcagtagcctga

DBGET integrated database retrieval system