KEGG   Oryctolagus cuniculus (rabbit): 100342213
Entry
100342213         CDS       T03373                                 
Symbol
LDLRAP1
Name
(RefSeq) low density lipoprotein receptor adaptor protein 1
  KO
K12474  low density lipoprotein receptor adapter protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100342213 (LDLRAP1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    100342213 (LDLRAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100342213 (LDLRAP1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100342213 (LDLRAP1)
SSDB
Motif
Pfam: PID_2 PID PTB
Other DBs
NCBI-GeneID: 100342213
NCBI-ProteinID: XP_002716015
Ensembl: ENSOCUG00000008056
UniProt: G1SUD3
LinkDB
Position
13:complement(128122335..128144872)
AA seq 308 aa
MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQ
PKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTDQLIENVSIYRISYCT
ADKVHDKVFAYIVQSQHSENLECHAFLCTKRKMAQAVTLTVAQAFRVAFEFWQVSKEEKE
KREKASQEGGDAVGTRRDSAPSLKNQVATGNLLDLEEMAKAPLSTVSANTTNMDEAPRSQ
ALGSSSVVWELDDGLDEAFSRLAQSRTNPQLLDTGLTAQDIHYAQCLSPVDWDKPESSGP
EQEDLFSF
NT seq 927 nt   +upstreamnt  +downstreamnt
atggacgcgctcaagtccgcggggcgggcactgatccggagccccagcctggccaagcag
agctgggggggcggcggccggcatcgcaagctgcccgagaactggacggacacccgggag
acgctgctggagggcatgctgttcagcctcaagtacctgggcatgacgctggtggagcag
cccaagggcgaggagctgtcggccgccgccgtgaagaggatcgtggccacggccaaggcc
agcgggaagaagctgcagaaagtgaccctcaaggtgtcgcctcggggcatcatcctgacc
gacaacctcaccgaccagctcatcgagaacgtgtccatttacaggatctcctactgcacg
gccgacaaggtgcacgacaaggtgtttgcctacatcgtccagagccagcacagcgagaac
ctcgagtgccacgccttcctctgcaccaagcgcaaaatggcgcaggctgtcaccctcacc
gtcgcccaggccttcagagtcgccttcgagttttggcaggtgtccaaggaagagaaagag
aagagggagaaagccagccaggagggcggggacgccgtggggacccgccgggacagcgcc
ccgtcgctgaagaaccaggtcgccaccgggaacctgctggacttggaagagatggccaag
gccccgctgtccacggtcagcgccaacaccactaacatggatgaggcaccgcggtcccaa
gccttgggcagcagcagtgttgtctgggaactggacgatggcctggacgaagcgttctca
aggctggcccagtcgcgcaccaaccctcagctgctggacacgggcctgacagcgcaggac
atccactacgcccagtgcctgtcacctgtcgactgggacaagcctgagagcagtggcccc
gagcaggaagacctcttcagtttctga

DBGET integrated database retrieval system