KEGG   Oryctolagus cuniculus (rabbit): 100342249
Entry
100342249         CDS       T03373                                 
Symbol
TAB2
Name
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100342249 (TAB2)
   04064 NF-kappa B signaling pathway
    100342249 (TAB2)
   04668 TNF signaling pathway
    100342249 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100342249 (TAB2)
   04621 NOD-like receptor signaling pathway
    100342249 (TAB2)
   04657 IL-17 signaling pathway
    100342249 (TAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100342249 (TAB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100342249 (TAB2)
   05161 Hepatitis B
    100342249 (TAB2)
   05171 Coronavirus disease - COVID-19
    100342249 (TAB2)
   05162 Measles
    100342249 (TAB2)
   05168 Herpes simplex virus 1 infection
    100342249 (TAB2)
   05169 Epstein-Barr virus infection
    100342249 (TAB2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100342249 (TAB2)
   05135 Yersinia infection
    100342249 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100342249 (TAB2)
   05140 Leishmaniasis
    100342249 (TAB2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100342249 (TAB2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100342249 (TAB2)
SSDB
Motif
Pfam: CUE zf-RanBP HIP1_clath_bdg DivIC
Other DBs
NCBI-GeneID: 100342249
NCBI-ProteinID: XP_017193828
Ensembl: ENSOCUG00000012180
UniProt: G1T2S3
LinkDB
Position
Un
AA seq 693 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGNRMNGSRTLTHSISDGQLQGGQSNNE
LFQQEPQTAPAQVPQGFNVFGMSSTSGASNSTPHLGFHLGSKGASNLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPSGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTYPASNPLPHTSAQQSSQQGHQTSHVYMPISSPTTPQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRSSGPRTSSSSSSVNSQTL
NRNQPTVYIAASPPNTDEVISRSQPKVYISANATTGDEQVLRNQPTLFISTNSGASAASR
NVSGQVSMGPAFIHHHPPKSRAIGSNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTEPTLAHVDRISEARKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSTIKTPKTQDT
DDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacagaagttc
cctgaagtgcctgaagtcgttgtgtccaggtgcatgctgcagaataataataacctggat
gcctgctgtgccgttctctctcaggagagtacaaggtatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttccctcaacttg
gacttgcagtcccagaacatttaccaccatggaagagaaggaaatagaatgaatggaagc
aggactctaacgcacagcattagtgatggacaacttcaaggtggtcagtccaataatgaa
ctgtttcaacaggagccacaaacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagtacatctggtgcttcaaattcaacaccacatcttggatttcacttaggc
agcaaaggagcatctaacctttctcaacaaactcccagatttaaccccatcatggtgacg
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatataaggccttacattaca
actcctagtggtacaactcgacagacacaacagcattctggctgggtgtctcagtttaat
cccatgaaccctcaacaagtctatcagccttcacagcctggtccctggactacttaccct
gcatctaaccctctgccacatacctcagcccagcaatcaagccagcaaggccaccagacc
tcccacgtctacatgcccatcagctcacccactaccccacagccgccaacgattcactca
tctggtagctcccagtcttctgcccatagccagtataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaaccaccacaaagaaacagttcttcaaaa
ttgcgttcttctgggcctcgaacctccagcagttcctcttcggtcaatagccagactcta
aatagaaaccagcccactgtttacatagctgccagtcctccgaacactgatgaggtcata
tcccgtagtcaacctaaggtctatatttcagcgaatgccaccacaggagatgaacaggtc
ctgcggaatcagcctaccctcttcatatccacaaactctggggcctctgccgcctccagg
aatgtgtctgggcaagtgagcatggggcctgcctttatccatcaccaccctcccaaaagt
cgagccataggcagtaactctgcaacttctcctcgagtggtggtcactcaacccaacaca
aaatacactttcaaaatcacagtttctcccaataaaccccctgcggtttcgccaggagtg
gtgtcccctacctttgaacttaccaatcttctcaaccatcctgatcattatgtagaaaca
gagaatattcagcacctcacggagcctacgttagcacatgtggatagaatcagtgaagca
cggaagttgagtatgggatctgatgatgctgcctacacacaagctcttttggtacaccag
aaggccagaatggaacggcttcaaagagaacttgagattcaaaagaaaaagctggataaa
ctaaaatcggaggtcaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattccatatcccagataccttccctcgaagaaatgcagcagttgagaagttgtaataga
cagctccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccaccatcaaaacaccaaagactcaagacacc
gacgatgatgagggggctcagtggaattgtactgcctgtacctttctgaaccaccccgcc
ttaatccgctgtgaacagtgtgagatgccgcggcatttctga

DBGET integrated database retrieval system