KEGG   Oryctolagus cuniculus (rabbit): 100342327
Entry
100342327         CDS       T03373                                 
Symbol
CRKL
Name
(RefSeq) CRK like proto-oncogene, adaptor protein
  KO
K04438  C-crk adapter molecule crk
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04510  Focal adhesion
ocu04666  Fc gamma R-mediated phagocytosis
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05100  Bacterial invasion of epithelial cells
ocu05135  Yersinia infection
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05211  Renal cell carcinoma
ocu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100342327 (CRKL)
   04012 ErbB signaling pathway
    100342327 (CRKL)
   04015 Rap1 signaling pathway
    100342327 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100342327 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100342327 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100342327 (CRKL)
   04062 Chemokine signaling pathway
    100342327 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100342327 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    100342327 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100342327 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342327 (CRKL)
   05206 MicroRNAs in cancer
    100342327 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100342327 (CRKL)
   05211 Renal cell carcinoma
    100342327 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100342327 (CRKL)
   05163 Human cytomegalovirus infection
    100342327 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100342327 (CRKL)
   05100 Bacterial invasion of epithelial cells
    100342327 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100342327
NCBI-ProteinID: XP_002719763
Ensembl: ENSOCUG00000000818
UniProt: G1SE50
LinkDB
Position
21:complement(4938276..4975293)
AA seq 303 aa
MSSARFDSSDRASWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPQMGSVSAPNLPI
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIVEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcttcggccaggttcgactcctcagaccgcgcctcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggcatgttcctggtgcgcgac
tcctccacctgccccggggattacgtgctctcggtgtcggagaactcgcgggtctcccac
tatatcatcaactcgctgcccaaccgccgctttaagatcggggaccaggagttcgaccac
ttgccggccctgctggagttctacaagatccactacctggacaccaccaccctcatcgag
cccgcgcccaggtatccaagcccacaaatgggatctgtctcggcacccaacctgcctata
gcagaagaaaatctggaatatgtacggactctctatgattttcctgggaatgatgctgaa
gacctgccttttaaaaaaggtgagatcctggtgatagtagagaagcctgaagaacagtgg
tggagcgcccggaacaaggatggtcgggtcgggatgatccctgttccttatgttgaaaag
ctcgtgagatcctcgccacacggaaagcacggaaataggaattccaatagctatgggatc
ccagaacctgctcatgcgtatgctcaacctcagaccacaactcctctacctgcagtttcc
agtactcctggggcagccatcaaccccttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtgccctgtgcttacgacaagacagccttggcattagaggtt
ggtgacattgtgaaagtcacgaggatgaatataaacggccagtgggaaggcgaggtgaac
gggcgcaaggggcttttcccctttacgcatgtcaaaatcattgaccctcaaaacccggat
gaaaacgagtga

KEGG   Oryctolagus cuniculus (rabbit): 100358552
Entry
100358552         CDS       T03373                                 
Symbol
CRK
Name
(RefSeq) CRK proto-oncogene, adaptor protein
  KO
K04438  C-crk adapter molecule crk
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04510  Focal adhesion
ocu04666  Fc gamma R-mediated phagocytosis
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05100  Bacterial invasion of epithelial cells
ocu05135  Yersinia infection
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05211  Renal cell carcinoma
ocu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100358552 (CRK)
   04012 ErbB signaling pathway
    100358552 (CRK)
   04015 Rap1 signaling pathway
    100358552 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100358552 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100358552 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100358552 (CRK)
   04062 Chemokine signaling pathway
    100358552 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100358552 (CRK)
   04935 Growth hormone synthesis, secretion and action
    100358552 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100358552 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358552 (CRK)
   05206 MicroRNAs in cancer
    100358552 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100358552 (CRK)
   05211 Renal cell carcinoma
    100358552 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100358552 (CRK)
   05163 Human cytomegalovirus infection
    100358552 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100358552 (CRK)
   05100 Bacterial invasion of epithelial cells
    100358552 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 100358552
NCBI-ProteinID: XP_002718935
Ensembl: ENSOCUG00000002844
UniProt: G1SIG2
LinkDB
Position
19:16658912..16693410
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVTLLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
PRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcaggcaacttcgactcggaggagcggagtagctggtactgggggcggctgagccgg
caggaggcggtgacgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacattgatagaaccagtttccaga
cccaggcagggtagtggagtgattctcaggcaagaggaggcagagtatgtgcgagccctc
tttgactttaatgggaatgatgaagaagatctcccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggcaagaggggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcctgat
gaggacttcagctga

DBGET integrated database retrieval system