KEGG   Oryctolagus cuniculus (rabbit): 100342531
Entry
100342531         CDS       T03373                                 
Symbol
RND1
Name
(RefSeq) Rho family GTPase 1
  KO
K07531  Rho family GTPase 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100342531 (RND1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100342531 (RND1)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rnd [OT]
    100342531 (RND1)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA PduV-EutP
Other DBs
NCBI-GeneID: 100342531
NCBI-ProteinID: XP_002711090
Ensembl: ENSOCUG00000025362
UniProt: G1U807
LinkDB
Position
4:complement(33168937..33177117)
AA seq 232 aa
MKERRTPQPVVVRCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQR
VELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETADSALKKWRAEILDYCPSTRV
LLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIF
RMASMVCLNKPSPAPPRSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaaggagagacgcactccccagccagtcgtggtcaggtgcaagctcgtcctagtggga
gacgtgcagtgcgggaagacggcgatgctgcaggtgctggctaaggactgctacccggag
acctacgtgcccaccgtgtttgagaattacacagcctgtttggagacagaggagcagaga
gtagagctcagcctctgggacacttcgggctctccctactatgacaacgtccgtccactc
tgctacagcgactcagacgccgtattgctgtgctttgatatcagccgtccggagacggcg
gacagtgcgcttaagaagtggagggcagaaatcctagattattgtcccagcacacgtgtt
ttgcttatcggctgcaagacagacctgcgaacagacctgagcactctgatggagctgtcc
caccagaagcaggcccccatctcctatgagcagggctgtgcaatagccaagcagctgggt
gcagaaatctacctggaagggtcagctttcacctccgagaagagcatccacagcatcttc
cggatggcctctatggtgtgcctgaacaagcccagcccagcgcccccacggagccccgtc
cggagcctctccaaacggctgctgcacctccccagtcgctctgaactcatctcctccacc
ttcaagaaggaaaaggccaaaagctgttcgatcatgtga

DBGET integrated database retrieval system