KEGG   Oryctolagus cuniculus (rabbit): 100342812
Entry
100342812         CDS       T03373                                 
Symbol
SHC1
Name
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04510  Focal adhesion
ocu04650  Natural killer cell mediated cytotoxicity
ocu04722  Neurotrophin signaling pathway
ocu04910  Insulin signaling pathway
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05034  Alcoholism
ocu05100  Bacterial invasion of epithelial cells
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05220  Chronic myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100342812 (SHC1)
   04014 Ras signaling pathway
    100342812 (SHC1)
   04072 Phospholipase D signaling pathway
    100342812 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100342812 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100342812 (SHC1)
   04062 Chemokine signaling pathway
    100342812 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100342812 (SHC1)
   04915 Estrogen signaling pathway
    100342812 (SHC1)
   04917 Prolactin signaling pathway
    100342812 (SHC1)
   04926 Relaxin signaling pathway
    100342812 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    100342812 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100342812 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100342812 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100342812 (SHC1)
   05226 Gastric cancer
    100342812 (SHC1)
   05214 Glioma
    100342812 (SHC1)
   05220 Chronic myeloid leukemia
    100342812 (SHC1)
   05224 Breast cancer
    100342812 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100342812 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    100342812 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100342812 (SHC1)
   01522 Endocrine resistance
    100342812 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100342812
NCBI-ProteinID: XP_008262588
Ensembl: ENSOCUG00000016188
LinkDB
Position
13:37692287..37700437
AA seq 583 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGRAAEDGEGITGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCGRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEELPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGTVRPAPPSAQTPSHLGATLPVGQPVGGDPEVRKQMPPQPPCPGRE
LFDDPSYVNVQNLDKARQAGGGAGPPNATANGSAPRDLFDMKPFEDALRVPAPPQSVSMA
EQLQREPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatctcttgccccccaagcccaagtacaacccacttcggaatgagtctctgtcgtcg
ctggaagagggggcttcagggtccacccctccggaggagctgccttccccttcagcctcg
tccctggggccaatcctgccccctctgccgggggacgacagtcccaccaccctgtgctcc
ttcttcccccggatgagcaacctgaagctggccaaccctgctgggggccgcctggggccc
aagggggagccaggaagggcagccgaggatggggaggggatcacaggggcagccatgccg
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgccctcgac
ttcaacacccggacgcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggagccacgcggaggagaaagccctgtggccgcccgctcagctctatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgtaaacagatcattgccaaccaccacatgcagtctatc
tcatttgcgtccggcggagatccggacacagccgagtatgttgcctacgttgccaaagac
cccgtgaatcagagagcctgccacatcctggagtgtcccgaaggacttgcccaggatgtc
atcagcaccattggccaggccttcgagttacgcttcaaacaatacctcaggaacccaccc
aagctggtcaccccccatgacagaatggccggctttgatggatcagcttgggatgaggag
gaggaagagctacccgaccatcagtactataatgacttcccggggaaggaaccccctttg
gggggcgtggtggacatgaggctccgggaaggagctgccccagggactgttcgacctgct
ccacccagtgcgcagacccccagccacttgggagctaccctgcccgtagggcagcctgtg
ggaggagacccggaagtccgcaaacagatgccacctcaaccaccttgcccgggcagagag
ctctttgatgatccctcctacgtcaacgtccaaaacctagacaaggcccggcaggcaggg
ggaggggctgggccccccaacgcgaccgccaatggcagcgcaccccgggacctctttgac
atgaagccctttgaagatgcgcttcgggtacctgcacctccccagtcggtgtccatggct
gagcagctccaaagggagccctggttccatgggaagctgagccggcgggaggctgaggcg
ctgctgcagctcaacggggacttcctggtgcgggagagcacgaccacacctggccagtac
gtgctcaccggcctgcagagcgggcagcccaagcacctgctcctggtggaccccgagggt
gtggttcggacaaaggatcaccgctttgagagtgtcagccacctcatcagctaccacatg
gacaatcacttgcccatcatctctgcgggcagcgaactgtgtctccagcaacctgtggag
cggaaactgtga

KEGG   Oryctolagus cuniculus (rabbit): 100350676
Entry
100350676         CDS       T03373                                 
Symbol
SHC4
Name
(RefSeq) SHC adaptor protein 4
  KO
K17449  SHC-transforming protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04510  Focal adhesion
ocu04650  Natural killer cell mediated cytotoxicity
ocu04722  Neurotrophin signaling pathway
ocu04910  Insulin signaling pathway
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05034  Alcoholism
ocu05100  Bacterial invasion of epithelial cells
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05220  Chronic myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100350676 (SHC4)
   04014 Ras signaling pathway
    100350676 (SHC4)
   04072 Phospholipase D signaling pathway
    100350676 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100350676 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100350676 (SHC4)
   04062 Chemokine signaling pathway
    100350676 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100350676 (SHC4)
   04915 Estrogen signaling pathway
    100350676 (SHC4)
   04917 Prolactin signaling pathway
    100350676 (SHC4)
   04926 Relaxin signaling pathway
    100350676 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    100350676 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100350676 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100350676 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100350676 (SHC4)
   05226 Gastric cancer
    100350676 (SHC4)
   05214 Glioma
    100350676 (SHC4)
   05220 Chronic myeloid leukemia
    100350676 (SHC4)
   05224 Breast cancer
    100350676 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100350676 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    100350676 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100350676 (SHC4)
   01522 Endocrine resistance
    100350676 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100350676
NCBI-ProteinID: XP_008267264
Ensembl: ENSOCUG00000006438
UniProt: G1SR04
LinkDB
Position
17:23455421..23595999
AA seq 630 aa
MRERGQDCPAGLVLCVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGGSVGNKGSPQPPC
PALAPHLPAEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSLSRAGSAPPPQPDLLGHRATALTPNACPLPGPGEPAPRPRQDKQ
YLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGTNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNASCESEEV
HIDGPAEEREGPEYYNEIPGKQPPAGGVSDVRAKVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNTHERGVPFPREASLMKHTCRVDLFDDPCYINTQALQSTLGCARD
QSSGQPPGNSWHRGKTPETVQPGATAQPASSHSLPHIKQQLWNEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIVSSGSEVSLKQPVRKDNTPGLLQSKK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggccaggactgcccggcaggactcgtgctgtgtgtaggactcttcggg
caccccggcatgctgcacagggccaagtacagccgctttcggaacgagtccatcacgtct
ttggacgaaggcagccccggaggctcggtagggaacaaaggctcgccgcagcctccctgc
cccgccctggcaccccacctgcctgcggaagatgccaccttgccgtcccaggagagcccc
accccgctgtgcaccttgatccctcgcatggcgagcatgaagctggccaacccagccact
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtgccccggctgaagctccag
gaaagccaggacccggctcccagcagccccgcttcccccgaaaccagtctaagtagggcc
gggtctgcaccgccaccgcagccggacctgctggggcacagggcgaccgccttgactcct
aatgcttgcccgcttcccggccctggagagccagcccccaggcccaggcaggacaagcag
tacctgcagcacctgttggggatgggcatgaactactgcgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgaggtcactggattttggaatgagaacccaagtgacaagggaa
gcaataagtcgcctgtgtgaagctgtccctggggcaaacggagccattaaaaagcgaaag
cccccagtgaagttcctgtcaacagttcttggcaaaagtaatcttcagttttcgggaacg
aatataaaactgaccatctcaacatgcagcctcacactgatgaatcttgacaatcaacag
attattgcaaatcatcatatgcagtctatttcatttgcttctggaggggatcctgatact
acagactatgttgcctatgtagctaaagatccagttaatcaacgagcctgccacattctg
gaatgccgcagcggaatggctcaagacgtcataagcaccatagggcaggcttttgaactc
cggtttaaacagtacttgaaaaatccttctttgaatgcttcttgtgaaagtgaggaggtg
cacattgatggcccagctgaagagagggaaggtcctgagtattacaatgagatcccaggg
aagcagccacctgctggtggtgtctccgacgtacgcgccaaagttcaagccacagaacaa
atggcttactgccccatccggtgtgaaaagttgtgctatctgcctggaaactccaagtgc
agcagtgtgtacgagaactgtttagaacaaagcagggcaataggtaacacccatgagcga
ggagtgccgttcccacgagaggcctcattaatgaagcacacgtgtcgagtggacctcttt
gacgacccttgctacattaacacgcaggctcttcaaagcacacttggctgtgccagagat
cagagctcaggtcagccaccggggaactcatggcatcgtggaaagacaccagaaactgtt
caaccaggtgccacagcccagcctgccagctcgcattccttgccacacattaagcagcag
ctgtggaatgaagagtgttaccatggcaagctgagcaggaaggcggcagagagcctcttg
gttaaggacggggactttttggttcgagagagtgcaacctcccctggccagtatgtgctg
agtggactccagggaggccaggcgaaacatctgctcctggtggatcctgaaggcaaggtg
aggaccaaggatcacgtgtttgataatgttggccaccttatcagataccatatggataac
agtttgccaatcgtctcttctggaagcgaagtaagccttaaacaaccagtgaggaaagat
aatactccagggcttttgcagtctaagaaatga

KEGG   Oryctolagus cuniculus (rabbit): 100353992
Entry
100353992         CDS       T03373                                 
Symbol
SHC3
Name
(RefSeq) SHC adaptor protein 3
  KO
K17448  SHC-transforming protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04510  Focal adhesion
ocu04650  Natural killer cell mediated cytotoxicity
ocu04722  Neurotrophin signaling pathway
ocu04910  Insulin signaling pathway
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05034  Alcoholism
ocu05100  Bacterial invasion of epithelial cells
ocu05214  Glioma
ocu05220  Chronic myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100353992 (SHC3)
   04014 Ras signaling pathway
    100353992 (SHC3)
   04072 Phospholipase D signaling pathway
    100353992 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100353992 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100353992 (SHC3)
   04062 Chemokine signaling pathway
    100353992 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100353992 (SHC3)
   04915 Estrogen signaling pathway
    100353992 (SHC3)
   04917 Prolactin signaling pathway
    100353992 (SHC3)
   04926 Relaxin signaling pathway
    100353992 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    100353992 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100353992 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100353992 (SHC3)
   05226 Gastric cancer
    100353992 (SHC3)
   05214 Glioma
    100353992 (SHC3)
   05220 Chronic myeloid leukemia
    100353992 (SHC3)
   05224 Breast cancer
    100353992 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100353992 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    100353992 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100353992 (SHC3)
   01522 Endocrine resistance
    100353992 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100353992
NCBI-ProteinID: XP_017197920
Ensembl: ENSOCUG00000015412
LinkDB
Position
1:78578313..78757961
AA seq 479 aa
MSASRKGRPGDEPLPRXPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLTVSTASLNLRTPD
SKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPSKIPVLQDRMQSLDEPWTEEEGEGSDHPYYNSVPSKMPPPGGFLDARL
KNRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQAPVRQGSLDIYSTPEGKPHMAPAGE
APTYVNTQRMPPQAQPAATSSAESSPRRDLFDMKPFEDALKNQSLGPVLNKAASVECISP
VSPRAPDAKMLETLQAEPWYQGEMSRKEAEGLLEKDGDFLVRKSTTNSGSFVLTGMHNGQ
AKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSVPIVSAGSELCLQQPVERRPPGDQG
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgcctccaggaagggccggccgggcgacgagccgctgcccaganccccgcggggg
gcgccgcacgccagcgaccaggtgctggggccgggagtcacctacgtggtcaagtacttg
ggctgcattgaagttctacgctctatgcggtctcttgacttcagtacaagaacacagatt
accagggaagccatcagccgtgtctgtgaagctgtgcctggtgccaaaggagccttcagg
aagagaaagccgcccagcaaaatgctgtccagcatcctggggaagagcaacctccagttc
gcggggatgagcatctctctgaccgtctctaccgccagcctcaacctgaggacgcccgac
tccaaacagattatcgcgaatcatcacatgcagtccatctccttcgcctcggggggagac
ccggacacaacagactatgtcgcctatgtagcaaaggaccctgttaaccgcagagcttgt
cacatcctggaatgctgtgatgggctggcccaggatgtcatcggctccatcgggcaggcc
ttcgagctccggtttaaacaatacttgcagtgcccttccaagattcctgtcctccaggac
cgaatgcagagtctggatgagccctggacagaggaagagggggagggctcagaccaccca
tactacaacagtgttcccagcaagatgcctccaccagggggctttcttgatgctcgactg
aaaaacagaccccatgctcctgacacagctcagtttgcagggaaagagcaaacttactac
cagggaagacacttgggagacacatttggcgaagactggcagcaggcacctgtcaggcaa
gggtccttggacatctacagcacgccagaagggaaaccacacatggcccctgcgggagaa
gcacccacctacgtcaacacccagcgcatgcccccacaggcccagccggcggccaccagc
agcgcagagagcagcccacgcagggacctctttgacatgaaaccttttgaagatgctctc
aagaatcagtccttagggcctgtgttgaacaaggcagcctccgtggagtgcatcagtcct
gtctcaccccgagctccggatgccaagatgctggagacactgcaggccgagccttggtac
caaggagagatgagcaggaaggaggcggaagggctgctggagaaagatggagacttcctc
gtcaggaagagcaccaccaactccggctccttcgtcctcacaggcatgcacaacggccag
gccaagcacctgctgcttgtggaccctgaaggcacgatccgcacaaaggacagggtcttc
gacagcatcagccacctcatcaaccaccacctggagagtagcgtgcccatcgtctcggcg
gggagcgagctgtgcctgcagcagccggtggagaggagacccccgggagaccagggctag

DBGET integrated database retrieval system