KEGG   Oryctolagus cuniculus (rabbit): 100342816
Entry
100342816         CDS       T03373                                 
Symbol
AZI2
Name
(RefSeq) 5-azacytidine induced 2
  KO
K12651  5-azacytidine-induced protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100342816 (AZI2)
SSDB
Motif
Pfam: TBD Prefoldin_2
Other DBs
NCBI-GeneID: 100342816
NCBI-ProteinID: XP_017202242
Ensembl: ENSOCUG00000014956
UniProt: A0A5F9CI46
LinkDB
Position
14:complement(15135101..15173593)
AA seq 392 aa
MDALVEDDICILNHEKAHRRDPVTPVSIYAGDESVASHFALVTAYEDIKKRLKDSEKENS
LLKKRIRFLEEKLIGARFDEETSSVGREQVNKAYHAYREVCIDRDNLKNKLDKMNKDNSE
SLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNSPSSNWEVEKLNCDLKIHGLEKELELM
RKECSNLKIELQKAKQTDPSEDDNLKNCTLQRVSISSDNMQHAYWELKREMSNLHLVTQV
QAELLRKLKTPTTIKKAYTPAACTEDLGKDSTKLHLTNFTASYKRHAPLSPNGKAVCHTT
SSPFPGDTKILSEKEVLQSWTDNERSIPNDGTNFQEHNSYSRNSLEDNSWVFPSPPKSSE
TAFGETKSKTSPLPNLPSLHYLDQHNQNCLYK
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggatgcactcgtagaagatgatatttgcattctgaatcatgagaaagcccataggaga
gatccagtgactccagtctcaatatatgcaggagatgaatctgttgcttcacattttgcc
cttgtcactgcatatgaagatatcaaaaaacgacttaaagattcagaaaaggagaactct
ctcttgaagaaaagaataaggtttttggaagaaaagctaataggggctcgattcgatgaa
gaaacaagttctgtgggacgagaacaagtaaataaggcctatcatgcatatcgagaggtt
tgcattgatagagataatttgaagaacaaattggataaaatgaataaagacaactctgaa
tctctgaaagtgttgaacgaacaactacaatcaaaagaagtagaactcctccagctaaga
acagaagtggaaactcagcaggtgatgaggaatttaaattctccttcatcaaactgggag
gtggaaaaattgaactgtgacctgaagatccatggtttggaaaaggagctggaattgatg
aggaaagaatgtagcaatctcaaaatagaactacaaaaggccaagcaaacggatccatct
gaggatgacaacctgaagaactgcactctccaaagagtaagcatttcaagtgataatatg
cagcatgcatactgggaactgaagagagagatgtctaatctacatctggtgactcaagta
caagctgaactactaagaaaactgaaaactccaactacaatcaagaaagcctatacccca
gcagcctgcactgaagaccttgggaaagatagcacaaaactccacttgacaaattttact
gcatcctacaaaagacatgcccccctctcaccaaatggcaaagctgtctgtcatactaca
tcttccccttttccaggagatacaaagattttatcagagaaagaagttctccaatcatgg
acagataatgagagatctattcctaatgatggtacaaactttcaggaacacaactcctac
agcagaaattctctagaagataattcttgggtatttccaagccctcctaaatcaagtgag
acagcatttggggaaactaaaagtaaaacttcgcctttacccaatctgccatcactgcat
tacttggatcaacataaccaaaactgcctttataaataa

DBGET integrated database retrieval system