Oryctolagus cuniculus (rabbit): 100342931 Help Entry 100342931         CDS       T03373                                  Name (RefSeq) interferon beta   KO K05415   interferon beta Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04380   Osteoclast differentiation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04668   TNF signaling pathway ocu04936   Alcoholic liver disease ocu05135   Yersinia infection ocu05142   Chagas disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100342931    04668 TNF signaling pathway     100342931    04151 PI3K-Akt signaling pathway     100342931  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100342931    04650 Natural killer cell mediated cytotoxicity     100342931   09158 Development and regeneration    04380 Osteoclast differentiation     100342931  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100342931    05161 Hepatitis B     100342931    05160 Hepatitis C     100342931    05171 Coronavirus disease - COVID-19     100342931    05164 Influenza A     100342931    05162 Measles     100342931    05163 Human cytomegalovirus infection     100342931    05167 Kaposi sarcoma-associated herpesvirus infection     100342931    05169 Epstein-Barr virus infection     100342931    05165 Human papillomavirus infection     100342931   09171 Infectious disease: bacterial    05135 Yersinia infection     100342931    05152 Tuberculosis     100342931   09174 Infectious disease: parasitic    05142 Chagas disease     100342931   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100342931   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100342931  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100342931 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100342931 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Forkhead Motif Other DBs NCBI-GeneID:  100342931 NCBI-ProteinID:  XP_051701110 Ensembl:  ENSOCUG00000021649 LinkDB All DBs Position 1:46757934..46759959 Genome browser AA seq 180 aa AA seqDB search MINRCILQIALLLCFSTTALSMSYNSLQIQLWHGSLTCAKLLLQLNGTTEDCLNERINFK VPKEIKEPQQLQKEDTTLVIFEMLNNIFDIFRKNFSSTGWNETLVENLLGETHLQIHHLK SKINKKVTLESIRMNLRLKSYYWRIMDYLETKQYSNCAWKIVQLEIFRNFSFIIMLIDYL NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgatcaacaggtgtatccttcaaatcgctctcctgttgtgcttctccaccacagctcta tccatgagctacaactcgcttcagatccaactatggcacggaagtctgacgtgtgcgaag ctcctgctccagttgaatggaacgactgaggactgcctcaatgagaggataaacttcaaa gtccccaaggagattaaggaaccacaacagctccagaaagaagacaccaccttggttatc tttgaaatgctcaacaacatctttgacattttcagaaaaaatttctctagcactggctgg aatgagacccttgttgagaaccttcttggtgaaacccatttgcagattcatcatctgaag agcaaaataaacaaaaaggtaaccttggagagcatcagaatgaatctacgcctgaagagc tattactggaggatcatggattatctggagaccaagcagtatagcaactgtgcctggaaa atagtccagttggaaatcttcaggaacttttcctttatcatcatgctcatagattacctc taa

Oryctolagus cuniculus (rabbit): 100353390 Help Entry 100353390         CDS       T03373                                  Name (RefSeq) interferon alpha-21-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100353390    04151 PI3K-Akt signaling pathway     100353390  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100353390    04650 Natural killer cell mediated cytotoxicity     100353390  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100353390   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100353390    05161 Hepatitis B     100353390    05160 Hepatitis C     100353390    05171 Coronavirus disease - COVID-19     100353390    05164 Influenza A     100353390    05162 Measles     100353390    05163 Human cytomegalovirus infection     100353390    05167 Kaposi sarcoma-associated herpesvirus infection     100353390    05169 Epstein-Barr virus infection     100353390    05165 Human papillomavirus infection     100353390   09171 Infectious disease: bacterial    05152 Tuberculosis     100353390   09163 Immune disease    05320 Autoimmune thyroid disease     100353390   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100353390   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100353390  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100353390 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100353390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100353390 NCBI-ProteinID:  XP_002708102 UniProt:  A0A7R8C371 LinkDB All DBs Position 1:46438311..46438942 Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLSCLQDRHDFE CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI WQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcagaggaaatgcctctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc tggcaagaaagaatttggagcaaggaatga

Oryctolagus cuniculus (rabbit): 100354654 Help Entry 100354654         CDS       T03373                                  Name (RefSeq) interferon alpha-21-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100354654    04151 PI3K-Akt signaling pathway     100354654  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100354654    04650 Natural killer cell mediated cytotoxicity     100354654  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100354654   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100354654    05161 Hepatitis B     100354654    05160 Hepatitis C     100354654    05171 Coronavirus disease - COVID-19     100354654    05164 Influenza A     100354654    05162 Measles     100354654    05163 Human cytomegalovirus infection     100354654    05167 Kaposi sarcoma-associated herpesvirus infection     100354654    05169 Epstein-Barr virus infection     100354654    05165 Human papillomavirus infection     100354654   09171 Infectious disease: bacterial    05152 Tuberculosis     100354654   09163 Immune disease    05320 Autoimmune thyroid disease     100354654   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100354654   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100354654  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100354654 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100354654 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  100354654 NCBI-ProteinID:  XP_002708106 Ensembl:  ENSOCUG00000027561 UniProt:  G1TKA0 LinkDB All DBs Position 1:complement(46490177..46490784) Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLNDRRSSMLLGQMRRVSPLSCLQDRHDFE CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKKYSPCAWEVVRAEARRAVSLSRI WQERLWRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcaatgacaggaggtcctccatgctc ctgggacaaatgaggagagtctcccctctttcctgcttgcaggacagacatgactttgag tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc catgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactctgca tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc tggcaagaaagattatggcgcaaggaatga

Oryctolagus cuniculus (rabbit): 100355669 Help Entry 100355669         CDS       T03373                                  Name (RefSeq) interferon alpha-21-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100355669    04151 PI3K-Akt signaling pathway     100355669  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100355669    04650 Natural killer cell mediated cytotoxicity     100355669  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100355669   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100355669    05161 Hepatitis B     100355669    05160 Hepatitis C     100355669    05171 Coronavirus disease - COVID-19     100355669    05164 Influenza A     100355669    05162 Measles     100355669    05163 Human cytomegalovirus infection     100355669    05167 Kaposi sarcoma-associated herpesvirus infection     100355669    05169 Epstein-Barr virus infection     100355669    05165 Human papillomavirus infection     100355669   09171 Infectious disease: bacterial    05152 Tuberculosis     100355669   09163 Immune disease    05320 Autoimmune thyroid disease     100355669   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100355669   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100355669  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100355669 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100355669 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  100355669 NCBI-ProteinID:  XP_002708110 Ensembl:  ENSOCUG00000036366 UniProt:  A0A7R8GV21 LinkDB All DBs Position 1:46546127..46546696 Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLACLQDRHDFE FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEETPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI WQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc ctgggacaaatgaggagagtctcccctcttgcctgcttgcaggacagacatgactttgag ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagacacccctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcggaagccaggagagccgtctctttatcaagaatc tggcaagaaagaatttggagcaaggaatga

Oryctolagus cuniculus (rabbit): 100355912 Help Entry 100355912         CDS       T03373                                  Name (RefSeq) interferon alpha-5-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100355912    04151 PI3K-Akt signaling pathway     100355912  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100355912    04650 Natural killer cell mediated cytotoxicity     100355912  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100355912   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100355912    05161 Hepatitis B     100355912    05160 Hepatitis C     100355912    05171 Coronavirus disease - COVID-19     100355912    05164 Influenza A     100355912    05162 Measles     100355912    05163 Human cytomegalovirus infection     100355912    05167 Kaposi sarcoma-associated herpesvirus infection     100355912    05169 Epstein-Barr virus infection     100355912    05165 Human papillomavirus infection     100355912   09171 Infectious disease: bacterial    05152 Tuberculosis     100355912   09163 Immune disease    05320 Autoimmune thyroid disease     100355912   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100355912   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100355912  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100355912 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100355912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100355912 NCBI-ProteinID:  XP_002708111 Ensembl:  ENSOCUG00000031030 UniProt:  A0A7R8GV81 LinkDB All DBs Position 1:46572719..46573288 Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDRRSSMLLGQMRRVSPLSCLQDRHDFE CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI LQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcagtgacaggaggtcctccatgctc ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc ttgcaagaaagaatttggagcaaggaatga

Oryctolagus cuniculus (rabbit): 100356419 Help Entry 100356419         CDS       T03373                                  Name (RefSeq) interferon alpha-14-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100356419    04151 PI3K-Akt signaling pathway     100356419  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100356419    04650 Natural killer cell mediated cytotoxicity     100356419  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100356419   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100356419    05161 Hepatitis B     100356419    05160 Hepatitis C     100356419    05171 Coronavirus disease - COVID-19     100356419    05164 Influenza A     100356419    05162 Measles     100356419    05163 Human cytomegalovirus infection     100356419    05167 Kaposi sarcoma-associated herpesvirus infection     100356419    05169 Epstein-Barr virus infection     100356419    05165 Human papillomavirus infection     100356419   09171 Infectious disease: bacterial    05152 Tuberculosis     100356419   09163 Immune disease    05320 Autoimmune thyroid disease     100356419   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100356419   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100356419  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100356419 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100356419 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100356419 NCBI-ProteinID:  XP_002708112 UniProt:  A0A7R8GUW1 LinkDB All DBs Position 1:46602384..46602953 Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLLQTHSLNDGRSSMLLGQMRRVSPLSCLQDRHDFE CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI LQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcttcagacccacagcctcaatgacgggaggtcctccatgctc ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc ttgcaagaaagaatttggagcaaggaatga

Oryctolagus cuniculus (rabbit): 100356678 Help Entry 100356678         CDS       T03373                                  Name (RefSeq) interferon alpha-1/13   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100356678    04151 PI3K-Akt signaling pathway     100356678  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100356678    04650 Natural killer cell mediated cytotoxicity     100356678  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100356678   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100356678    05161 Hepatitis B     100356678    05160 Hepatitis C     100356678    05171 Coronavirus disease - COVID-19     100356678    05164 Influenza A     100356678    05162 Measles     100356678    05163 Human cytomegalovirus infection     100356678    05167 Kaposi sarcoma-associated herpesvirus infection     100356678    05169 Epstein-Barr virus infection     100356678    05165 Human papillomavirus infection     100356678   09171 Infectious disease: bacterial    05152 Tuberculosis     100356678   09163 Immune disease    05320 Autoimmune thyroid disease     100356678   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100356678   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100356678  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100356678 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100356678 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon DUF6559 Motif Other DBs NCBI-GeneID:  100356678 NCBI-ProteinID:  XP_002708113 UniProt:  A0A7R8GUY5 LinkDB All DBs Position 1:46622389..46622958 Genome browser AA seq 189 aa AA seqDB search MASAFCLVLVLVVFNCMSVCALNCDLPQTHSQNNKETFKKLREMRKVMGFFCMQYIHDFG LPREELEGHQVQKAQTIAVLHEVTQGVFTLFCAPDSSATWNNTILDILCSRLHQQLSDLE ACVKQEVEVKQTPTIQNPSVRAVNKYFRNIRLYLTEKEDSPCAWMTVTLEVSRAMSLSRF LQERLRSKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcctcggcattttgtcttgtgctggtgctggtagtattcaactgtatgtctgtctgt gctctgaattgtgatctacctcagactcacagccagaataacaaagaaactttcaagaag ctgagagaaatgaggaaagtgatgggcttcttctgcatgcagtacattcacgattttggg ttaccacgggaggagcttgaaggacaccaggtccagaaggctcaaactattgctgtgctg catgaggtgacccagggggtcttcacacttttctgcgcaccggactcatctgctacctgg aacaataccatcctggacatactgtgctctagactccaccagcagctgagtgacctggaa gcctgtgtgaagcaagaagtggaggtgaaacagacacccacgatacagaatccctctgta cgagctgtgaataagtacttcagaaatatccgcctctatctgacagagaaggaagacagc ccttgtgcctggatgactgtcacactagaagtttcgagagccatgtctttatcaagattc ttgcaagaaagattaagaagtaaggattga

Oryctolagus cuniculus (rabbit): 100357194 Help Entry 100357194         CDS       T03373                                  Name (RefSeq) interferon alpha-21-like   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100357194    04151 PI3K-Akt signaling pathway     100357194  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100357194    04650 Natural killer cell mediated cytotoxicity     100357194  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100357194   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100357194    05161 Hepatitis B     100357194    05160 Hepatitis C     100357194    05171 Coronavirus disease - COVID-19     100357194    05164 Influenza A     100357194    05162 Measles     100357194    05163 Human cytomegalovirus infection     100357194    05167 Kaposi sarcoma-associated herpesvirus infection     100357194    05169 Epstein-Barr virus infection     100357194    05165 Human papillomavirus infection     100357194   09171 Infectious disease: bacterial    05152 Tuberculosis     100357194   09163 Immune disease    05320 Autoimmune thyroid disease     100357194   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100357194   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100357194  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100357194 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100357194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100357194 NCBI-ProteinID:  XP_002708115 Ensembl:  ENSOCUG00000022525 UniProt:  G1TMS3 LinkDB All DBs Position 1:46634436..46635005 Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI WQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcctttctcttcactgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc tggcaagaaagaatttggagcaaggaatga

Oryctolagus cuniculus (rabbit): 100357708 Help Entry 100357708         CDS       T03373                                  Name (RefSeq) interferon alpha-21-like isoform X2   KO K05414   interferon alpha Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04151   PI3K-Akt signaling pathway ocu04217   Necroptosis ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04623   Cytosolic DNA-sensing pathway ocu04630   JAK-STAT signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04936   Alcoholic liver disease ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05320   Autoimmune thyroid disease ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100357708    04151 PI3K-Akt signaling pathway     100357708  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100357708    04650 Natural killer cell mediated cytotoxicity     100357708  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100357708   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100357708    05161 Hepatitis B     100357708    05160 Hepatitis C     100357708    05171 Coronavirus disease - COVID-19     100357708    05164 Influenza A     100357708    05162 Measles     100357708    05163 Human cytomegalovirus infection     100357708    05167 Kaposi sarcoma-associated herpesvirus infection     100357708    05169 Epstein-Barr virus infection     100357708    05165 Human papillomavirus infection     100357708   09171 Infectious disease: bacterial    05152 Tuberculosis     100357708   09163 Immune disease    05320 Autoimmune thyroid disease     100357708   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100357708   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100357708  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100357708 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interferons    100357708 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100357708 NCBI-ProteinID:  XP_002708117 Ensembl:  ENSOCUG00000020925 UniProt:  G1SHR2 LinkDB All DBs Position 1:complement(46674805..46679766) Genome browser AA seq 189 aa AA seqDB search MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI WQERIWSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag gtctgcatgatgcagggagcgggggcggaggagatgcctctgaagcatgaggactccgca tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc tggcaagaaagaatttggagcaaggaatga

DBGET integrated database retrieval system