KEGG   Oryctolagus cuniculus (rabbit): 100343113
Entry
100343113         CDS       T03373                                 
Symbol
CHMP1A
Name
(RefSeq) charged multivesicular body protein 1A
  KO
K12197  charged multivesicular body protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100343113 (CHMP1A)
  09143 Cell growth and death
   04217 Necroptosis
    100343113 (CHMP1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100343113 (CHMP1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100343113 (CHMP1A)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100343113 (CHMP1A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100343113 (CHMP1A)
  Exosomal proteins of other body fluids (saliva and urine)
   100343113 (CHMP1A)
  Exosomal proteins of colorectal cancer cells
   100343113 (CHMP1A)
SSDB
Motif
Pfam: Snf7 Ist1 DUF6247 DUF5871
Other DBs
NCBI-GeneID: 100343113
NCBI-ProteinID: XP_002723649
LinkDB
Position
Un
AA seq 196 aa
MDDTLFQLKFTAKQLEKLAKKAEKDAKAEQARVKKALQQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSAVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIVQIAEENGLEVLDQLSQLPEGAAAVGESST
RSQEDQLSRRLAALRN
NT seq 591 nt   +upstreamnt  +downstreamnt
atggacgatacgctgttccagctgaagttcacagcaaagcagctggagaagctggccaag
aaggcggagaaggacgccaaggctgagcaggccagggtgaagaaggccctgcagcagaaa
aatgtggagtgcgcccgtgtgtatgctgagaacgccatccgcaaaaagaacgaaggcgtg
aactggctccgcatggcgtcccgggtggacgctgtggcctccaaggtgcagacggctgtg
accatgaagggggtgaccaagaacatggcacaggtgaccaaagccctggataaggccctg
agcaccatggacctgcagaaggtctctgccgtgatggacaggttcgagcagcaggtgcag
aacctggatgtgcacacgtcggtgatggaggactccatgagctcggccaccacgctgacc
acgcctcaggagcaggtcgacagcctcattgtgcagattgccgaggagaacgggctggaa
gtcctggaccagctcagccagctgcccgagggcgccgctgccgtgggggagagctccacg
cgcagccaggaggaccagctgtcgcggaggttggccgccttgaggaattag

KEGG   Oryctolagus cuniculus (rabbit): 100349753
Entry
100349753         CDS       T03373                                 
Symbol
CHMP1B
Name
(RefSeq) charged multivesicular body protein 1B
  KO
K12197  charged multivesicular body protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349753 (CHMP1B)
  09143 Cell growth and death
   04217 Necroptosis
    100349753 (CHMP1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349753 (CHMP1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349753 (CHMP1B)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100349753 (CHMP1B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100349753 (CHMP1B)
  Exosomal proteins of other body fluids (saliva and urine)
   100349753 (CHMP1B)
  Exosomal proteins of colorectal cancer cells
   100349753 (CHMP1B)
SSDB
Motif
Pfam: Snf7 Ist1 FlxA Mu-like_Pro Mt_ATP-synt_D DUF948
Other DBs
NCBI-GeneID: 100349753
NCBI-ProteinID: XP_008259244
LinkDB
Position
9:complement(50076535..50078686)
AA seq 199 aa
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQSAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtccaacatggagaaacacctgttcaacctaaagtttgcggccaaagaactgagcagg
agtgccaaaaaatgcgataaggaggaaaaggccgaaaaggccaaaattaaaaaggccatt
cagaagggcaacatggaagttgcgaggatacacgccgaaaatgccatccgccagaagaac
caggcggtgaatttcttgagaatgagtgcgcgggtggatgcggtggctgccagagtccag
tcggcggtgacgatgggcaaggtgaccaagtcgatggccggtgtggttaagtcgatggat
gcgacattgaagaccatgaatctggagaagatctccgccctgatggacaaattcgagcac
cagtttgagacgctggacgtccagacgcagcaaatggaagacacgatgagcagcacgacg
acgctgaccactccccagaaccaagtggatatgctactccaggaaatggcagacgaggcc
ggtctcgacctcaacatggagctgccgcaggggcagacgggctctgtgggcacgagcgtg
gcgtcggccgagcaggatgaactgtcccagagactggcccgccttcgggatcaagtgtga

DBGET integrated database retrieval system