KEGG   Oryctolagus cuniculus (rabbit): 100343224
Entry
100343224         CDS       T03373                                 
Symbol
SIKE1
Name
(RefSeq) suppressor of IKBKE 1
  KO
K12656  suppressor of IKK-epsilon
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100343224 (SIKE1)
SSDB
Motif
Pfam: SIKE Herpes_BLRF2 DUF4250
Other DBs
NCBI-GeneID: 100343224
NCBI-ProteinID: XP_002715788
Ensembl: ENSOCUG00000016457
LinkDB
Position
13:49404469..49412962
AA seq 207 aa
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASD
VKDMSKYKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKK
AVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQVRKENSVDTASQAIK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagctgcaccatcgagaagattctgacggacgccaagacgctgctagagaggctgcgg
gagcacgatgcggccgccgagtcgctggtggatcagtcggcggcgctgcaccggcgagtg
gctgctatgcgggaggcggggacagcgcttccggaccagtatcaagaggatgcatccgat
gtgaaggatatgtccaaatacaaaccccacattctgctgtcccaagaaaacacacagatt
agagacttacagcaggaaaacagagagctctgggtttccctggaagaacaccaggatgct
ttggaactcatcatgagcaagtaccggaaacagatgctacagttaatggtcgctaaaaag
gcagtggatgctgaaccggtcctgaaagctcaccagtctcactctgcagaaattgagagt
cagattgacagaatctgtgaaatgggagaagtgatgaggaaagcagttcaggtagatgat
gaccagttctgtaagattcaggaaaagctagcccaattagagcttgaaaacaaggaacta
cgagaattattgtctatcagcagcgagtcacttcaggtcagaaaggagaattcagtggac
actgcttcccaagccatcaaataa

DBGET integrated database retrieval system