KEGG   Oryctolagus cuniculus (rabbit): 100343351
Entry
100343351         CDS       T03373                                 
Symbol
ANAPC11
Name
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100343351 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100343351 (ANAPC11)
   04114 Oocyte meiosis
    100343351 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100343351 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100343351 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343351 (ANAPC11)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100343351 (ANAPC11)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     100343351 (ANAPC11)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100343351 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-Nse zf-RING_UBOX
Other DBs
NCBI-GeneID: 100343351
NCBI-ProteinID: XP_017206343
Ensembl: ENSOCUG00000027501
UniProt: G1TPK6
LinkDB
Position
Un
AA seq 84 aa
MKVKIKCWNGMATWLWVANDKNCGICRMALNGCGPDCKMPGDNCLLVWGQCSHCFHMHCI
LKWLNTQQVQQHCPMRRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaagatcaagtgctggaacggcatggccacctggctttgggtggccaacgac
aagaactgcggcatctgccggatggcattaaatggctgcggccccgactgcaagatgccg
ggagacaactgcctgctagtctggggccagtgctctcactgcttccacatgcactgcatc
ctcaagtggctcaacacacagcaggtgcagcagcactgccccatgcgccggcaggagtgg
aagttcaaggagtga

KEGG   Oryctolagus cuniculus (rabbit): 100357094
Entry
100357094         CDS       T03373                                 
Name
(RefSeq) anaphase-promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100357094
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100357094
   04114 Oocyte meiosis
    100357094
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100357094
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357094
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100357094
   03036 Chromosome and associated proteins [BR:ocu03036]
    100357094
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     100357094
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100357094
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 100357094
NCBI-ProteinID: XP_017205110
LinkDB
Position
21:complement(5937892..5938198)
AA seq 92 aa
YGKFHGHPILPQSDALSRKYYWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCS
HCFHMHCILKWLNVQQVQQHCPMCRQEWKFKE
NT seq 279 nt   +upstreamnt  +downstreamnt
tatgggaagtttcatggtcatcccatacttccccagtctgatgctttgagcagaaaatat
tactggctctgggtggccaacgatgagaactgcggcatctgccggatggcattcaatggc
tgctgccccgactgcaaggtcccgggagacgactgcccgctggtctggggccagtgctcc
cactgcttccacatgcactgcatcctcaagtggctcaacgtgcagcaggtgcagcagcac
tgccccatgtgccggcaggagtggaagttcaaggagtga

DBGET integrated database retrieval system