KEGG   Oryctolagus cuniculus (rabbit): 100343384
Entry
100343384         CDS       T03373                                 
Symbol
MYL9
Name
(RefSeq) myosin light chain 9
  KO
K12755  myosin regulatory light chain 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04270  Vascular smooth muscle contraction
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu04921  Oxytocin signaling pathway
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100343384 (MYL9)
   04022 cGMP-PKG signaling pathway
    100343384 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100343384 (MYL9)
   04530 Tight junction
    100343384 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100343384 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100343384 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100343384 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100343384 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    100343384 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100343384 (MYL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100343384 (MYL9)
   04147 Exosome [BR:ocu04147]
    100343384 (MYL9)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100343384 (MYL9)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100343384 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH DUF3741 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 100343384
NCBI-ProteinID: XP_002710827
Ensembl: ENSOCUG00000000637
UniProt: G1SDR2
LinkDB
Position
4:complement(3443207..3448415)
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaggccaagaccacaaagaagcggccacagcgggccacgtcc
aatgtcttcgccatgtttgaccagtcccagatccaggagttcaaggaggccttcaacatg
atcgaccagaaccgtgacggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaaaaaccccacggacgaatacctggagggcatgatgagcgaggcgccggggccc
atcaacttcaccatgttcctcaccatgttcggggagaagctgaacggcaccgaccccgag
gacgtcatccgcaacgccttcgcctgctttgatgaggaggcctcaggcttcatacacgag
gaccacctgcgggagctgctcaccaccatgggggaccgcttcacagacgaggaggtggac
gagatgtaccgcgaggcgcccatcgacaagaagggcaacttcaactacgtggagttcacc
cgcatcctcaaacacggtgccaaggacaaggacgactga

KEGG   Oryctolagus cuniculus (rabbit): 100345591
Entry
100345591         CDS       T03373                                 
Name
(RefSeq) myosin regulatory light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100345591
   04530 Tight junction
    100345591
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100345591
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100345591
   04670 Leukocyte transendothelial migration
    100345591
  09158 Development and regeneration
   04360 Axon guidance
    100345591
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100345591
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100345591
   04147 Exosome [BR:ocu04147]
    100345591
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100345591
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100345591
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 DUF2666 DUF3741 SPARC_Ca_bdg 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 100345591
NCBI-ProteinID: XP_002713645
LinkDB
Position
9:complement(58776110..58804720)
AA seq 172 aa
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaaaggccaagaccaagaccaccaagaagcgccctcagcgcgccacgtcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaaccgagatggtttcattgacaaggaggatttgcacgatatgcttgcttca
ctggggaagaatcccacagatgcataccttgatgccatgatgaatgaggctccaggccct
atcaatttcaccatgttcctcactatgtttggtgagaagttgaatggtaccgatcctgaa
gacgtcatcagaaatgcttttgcatgcttcgatgaagaagccacaggcaccattcaggag
gactacctgagagagctgctgacaaccatgggagaccggtttacagacgaggaggtggac
gagctctacagagaagctcccattgacaaaaaggggaacttcaattacattgagttcaca
cgcatccttaaacatggagcgaaagacaaggatgactga

KEGG   Oryctolagus cuniculus (rabbit): 100346112
Entry
100346112         CDS       T03373                                 
Name
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12757  myosin regulatory light chain 12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100346112
   04530 Tight junction
    100346112
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100346112
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100346112
   04670 Leukocyte transendothelial migration
    100346112
  09158 Development and regeneration
   04360 Axon guidance
    100346112
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100346112
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100346112
   04147 Exosome [BR:ocu04147]
    100346112
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100346112
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100346112
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF3741 DUF2666
Other DBs
NCBI-GeneID: 100346112
NCBI-ProteinID: XP_017199548
LinkDB
Position
9:complement(58809971..58816489)
AA seq 178 aa
MDLTTTMSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDL
HDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEA
TGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 537 nt   +upstreamnt  +downstreamnt
atggacttaaccaccaccatgtcgagcaaaagggcaaagaccaagaccaccaagaagcgc
cctcagcgcgccacgtccaatgtgtttgccatgtttgaccagtcacagattcaggagttc
aaagaggccttcaacatgattgatcagaaccgagacggtttcattgacaaggaggatttg
cacgatatgcttgcttcactggggaaaaatccaactgatgagtatctggacgccatgatg
aatgaggctccaggccccatcaatttcaccatgtttctcaccatgtttggtgagaagttg
aatggcacagatccagaagatgtcatcagaaatgcttttgcttgctttgatgaagaagca
actggcaccattcaggaggactacctgagagagctgctgacaaccatgggagaccggttt
acagacgaggaggtggacgagctctacagagaagctcccattgacaaaaaggggaacttc
aattacattgagttcacacgcatccttaaacatggagcgaaagacaaggatgactga

DBGET integrated database retrieval system