KEGG   Oryctolagus cuniculus (rabbit): 100343468
Entry
100343468         CDS       T03373                                 
Symbol
AMPH
Name
(RefSeq) amphiphysin
  KO
K12562  amphiphysin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100343468 (AMPH)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100343468 (AMPH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100343468 (AMPH)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100343468 (AMPH)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    100343468 (AMPH)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100343468 (AMPH)
SSDB
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 HD_3 ATG17_like THP2 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 100343468
NCBI-ProteinID: XP_002713722
Ensembl: ENSOCUG00000002244
LinkDB
Position
10:complement(21545071..21669071)
AA seq 693 aa
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHAD
KAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTRKG
PPVPPLPKVTPTKELQQENIINFFEDNFVPEISVTTPSQNEVSEVKKEETLLDLDFDPFK
PEVASAGSGGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSM
ICNLAESEQAAPTEPKAEEAPAAATPAVGLDLGLDARAEEPVEEAAVLPGADADVAGGTM
VPAAEGIPGEEAEAEKAAVPAGEGVSVEEAKIGTEATEVVDSDRPYPEEMEAAAPQEKVI
PSVVIEPASNHEGEGEQEIIISAESEEAPEDAAATGPAGETPELTTEKPQEDAQASPATP
AGATDQQAPAGAAAQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDA
GWLVGVKEADWLQYRDLATYKGLFPENFTRRLD
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggccgacatcaagacgggcatcttcgccaagaacgtccagaagcgactcaaccgcgcg
caggaaaaggtgctccagaagctggggaaagctgatgaaaccaaagacgagcagtttgaa
gaatatgtccagaacttcaaacggcaagaagcagagggtaccagacttcagcgagaactc
cgaggatatttagcagcaatcaaaggcatgcaagaggcctccatgaagctcactgagtca
ctgcatgaagtctatgagccggactggtatggacgggaagatgtgaaaatggttggcgag
aaatgtgatgttctgtgggaagacttccatcaaaaactagtggatggatccttgctgaca
ctagatacctacctgggccagttcccagacataaagaatcgcatcgccaagcgcagcagg
aagctggtggactacgacagtgcccgccatcacctggaagccctgcagagctccaaacgg
aaggatgagagtaggatctcgaaggcagaagaagaatttcagaaagcccagaaagtgttt
gaagagtttaatgttgatctgcaagaagagttaccatcattatggtcgagacgagttgga
ttttatgttaatactttcaaaaatgtctccagtcttgaggccaagtttcataaggaaatt
gccgtgctttgccacaaattgtatgaagtgatgacaaaactgggcgaccagcacgctgac
aaggccttcaccattcaaggagctcccagcgattcgggccccctgcgcattgcaaagacg
ccatcaccaccagaggagccttcacccctgccaagcccgacagctagcccgaatcacacg
ctagcacctgcgtctcctgcacctgcccggcccaggtcaccttcacagacaaggaaaggg
cctcccgtcccacctctgcccaaagtcacgccaacgaaggaactacagcaggagaacatc
atcaatttctttgaggacaattttgttccagaaatcagcgtgacgacgccttcccagaat
gaagtctctgaggtgaagaaagaggagacgctgctggatctggactttgaccctttcaag
cctgaggtcgcatctgctggctctgggggcgtcacccactcacccatgtctcagacattg
ccttgggacctgtggacgacaagcactgatttggtacagccggcttctggtggttcattt
aatggattcacccagccccaggacacttcgttattcacaatgcagacagaccagagtatg
atctgcaacttggctgaatctgagcaggctgcacccacagagccgaaagcagaggaggcc
cctgctgctgccacacctgctgtcggactggacctgggactggatgctcgggccgaggag
ccagtggaggaggcagcggtgctccctggagctgatgctgatgtggccggtggaaccatg
gtgccggcagctgaggggatcccaggagaagaggcagaggcagagaaggcagctgtccca
gctggggaaggagtcagtgtagaagaggccaaaattggtaccgaagccaccgaggttgtg
gacagcgacagaccttacccagaagagatggaagcagcagcgccacaggagaaggtcatc
ccttctgtggtcatcgagcctgcctcaaaccatgaaggggagggagaacaagagataatc
atcagtgcagagtcggaggaagccccagaggacgctgctgccacaggccccgccggcgag
acaccagagctgaccacggagaagccccaggaggatgctcaggcatcgcctgctacacct
gcaggagccacagatcaacaagcacctgcaggggcggccgctcaggaattgcctcccggg
tttctctacaaggtagaaacactgcatgactttgaggcagcaaattctgatgaacttacc
ttgcagcggggtgacgtggtgctggtggtcccctcggattcagaagccgaccaggatgca
ggctggctggtgggagtgaaggaagcagactggcttcagtacagagaccttgccacctac
aaaggcctcttccccgagaacttcacccggcgcctggattag

KEGG   Oryctolagus cuniculus (rabbit): 100355195
Entry
100355195         CDS       T03373                                 
Symbol
BIN1
Name
(RefSeq) bridging integrator 1
  KO
K12562  amphiphysin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100355195 (BIN1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100355195 (BIN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100355195 (BIN1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100355195 (BIN1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    100355195 (BIN1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100355195 (BIN1)
SSDB
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 THP2
Other DBs
NCBI-GeneID: 100355195
NCBI-ProteinID: XP_017198263
LinkDB
Position
7:complement(58593425..58644488)
AA seq 609 aa
MADMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVD
QALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK
AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVN
TFQSIAGLEENFHKEMSKLNQNLNDVLVSLEKQQGSSTFAIKAQPRKKTKLFSRLRRKKN
SDNAPAKGNKSPSPPPDGSPAATPEIRVNHEPEPASGAAPGATIPKSPSQLRKGPPVPPP
PKHTPSKEIKQEQILSLFEDTFVPEISVTTPSQFEAPGRFSEQASLLDLDFDPLPPVASP
VKAPTPSGQPIPWDLWEPTESPAGSLPSREPSAAEGTFAVAWPSQTAEPGPAQPAEASEV
AGGTQPAAGAQEPGETAASEAASSSLPAVVVETFSATVNGAVEGGSGAGRPDLPPGFMFK
VQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVF
PENFTERVQ
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcagacatgggcagcaagggggtgacggcggggaagatcgccagcaacgtgcagaaa
aagctcacccgcgcgcaggagaaggtcctccagaagctggggaaagcggatgagaccaag
gacgagcagtttgaacagtgcgtgcagaacttcaacaagcagctgactgagggcacccgg
ctgcagaaagatctccggacctacctggcctctgtcaaagccatgcatgaggcctccaag
aagctgaacgaatgtctgcaggaggtgtacgagccagactggcccggcagggacgaggcc
aacaagatcgctgagaacaacgacctgttgtggatggattaccaccagaagctggtggac
caggcgctgctgaccatggacacgtacctgggccagtttcctgacatcaagtcacgcatt
gccaagcgggggcggaagctggtggactacgacagtgcccggcaccactacgagtccctt
cagacggccaagaagaaggacgaggccaagatcgccaagcctgtctcgctgcttgagaag
gccgccccccagtggtgccaaggcaaactgcaggctcacctcgtagcccaaactaacctg
ctccgaaatcaggccgaggaggagctcatcaaagcacagaaggtgtttgaagagatgaac
gtggatctgcaggaggagctgccgtccctgtggaacagccgcgtgggtttctacgtcaac
acgtttcagagcatcgcaggcctggaggagaacttccacaaggagatgagtaagctcaac
cagaacctcaacgacgtgctggtcagcctggagaaacagcagggcagcagcaccttcgcg
atcaaggcccagcccagaaagaaaaccaaactgttctcccggctgcgcaggaagaagaac
agcgacaacgcccctgccaaagggaacaagagcccttcgcctccgccagatggctcccct
gcagccactcctgagatcagagtcaaccacgagccagagccggccagcggggctgcccct
ggggccaccatccccaagtccccgtctcagctccggaaaggcccacccgtccctccgcct
cccaaacacaccccgtccaaggagatcaagcaggagcagatcctcagcctgtttgaggac
acgtttgtccccgagatcagcgtgaccaccccttcccagtttgaggccccagggcgattc
tcggagcaggccagtttgctggacctggacttcgaccccctcccgcccgtggcgagccct
gtgaaggcacccacgccctccggtcagcccatcccgtgggacctctgggagcccacagag
agtccagcaggcagcctgccttccagggagcccagcgctgctgagggcacctttgctgtg
gcctggcccagccagacggctgagccggggcctgcccaaccagcagaggcctcagaggtg
gcgggtgggacccagcctgcagccggagcccaggagcctggggagacggcggcaagcgaa
gcagcctctagctcccttcccgctgtggtggtggagaccttctcagcaactgtgaacggc
gccgtggagggcggcagcggggctgggcgcccagacctaccccctggcttcatgttcaag
gtgcaggcacagcacgactacacagccaccgacacggatgagctgcagctcaaggccggc
gacgtggtgctggtgatccccttccagaaccccgaggagcaggatgaaggctggcttatg
ggcgtgaaggagagcgactggaaccagcacaaggagctggagaaatgccggggcgtgttc
cccgagaacttcactgagcgggtgcagtga

DBGET integrated database retrieval system