KEGG   Oryctolagus cuniculus (rabbit): 100343571
Entry
100343571         CDS       T03373                                 
Symbol
MAP3K7
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04140  Autophagy - animal
ocu04152  AMPK signaling pathway
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04520  Adherens junction
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100343571 (MAP3K7)
   04310 Wnt signaling pathway
    100343571 (MAP3K7)
   04064 NF-kappa B signaling pathway
    100343571 (MAP3K7)
   04668 TNF signaling pathway
    100343571 (MAP3K7)
   04152 AMPK signaling pathway
    100343571 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100343571 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100343571 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100343571 (MAP3K7)
   04620 Toll-like receptor signaling pathway
    100343571 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    100343571 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    100343571 (MAP3K7)
   04660 T cell receptor signaling pathway
    100343571 (MAP3K7)
   04657 IL-17 signaling pathway
    100343571 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100343571 (MAP3K7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100343571 (MAP3K7)
   05161 Hepatitis B
    100343571 (MAP3K7)
   05171 Coronavirus disease - COVID-19
    100343571 (MAP3K7)
   05162 Measles
    100343571 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    100343571 (MAP3K7)
   05169 Epstein-Barr virus infection
    100343571 (MAP3K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100343571 (MAP3K7)
   05135 Yersinia infection
    100343571 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100343571 (MAP3K7)
   05140 Leishmaniasis
    100343571 (MAP3K7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100343571 (MAP3K7)
   05418 Fluid shear stress and atherosclerosis
    100343571 (MAP3K7)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100343571 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100343571 (MAP3K7)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100343571 (MAP3K7)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  MLK family
   100343571 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 100343571
NCBI-ProteinID: XP_002714630
Ensembl: ENSOCUG00000001698
UniProt: G1SFY3
LinkDB
Position
12:complement(77380160..77460577)
AA seq 606 aa
MSTASAASSSSSSSTSEMIEAPTQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNVEQVSATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATAAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPARSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcttcgtcttcgaccagtgagatgatcgaa
gcccctacccaggtccttaactttgaggagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagtggtttgcaaagctaaatggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcatttattgtggagcttcggcag
ttgtctcgggtgaaccatcccaatattgtaaagctatatggagcctgcttaaatccagta
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccttattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttaccttcacagcatgcaacccaaagctctaattcacagggacctgaaaccacca
aatttgctgctggttgcaggggggactgttctaaaaatctgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcatggatggcacctgaagtt
tttgaaggtagcaattacagtgaaaaatgtgacgtcttcagctggggcattatcctttgg
gaagtgataacacgtcggaaaccttttgatgaaattggtgggccggctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgatcaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagacccttctcagcgcccttccatggaggaaatt
gtgaaaataatgactcacttgatgcggtacttcccaggagcagatgagccattgcagtat
ccttgtcagtattcagatgaaggacagagtaattctgccaccagtacaggttcattcatg
gatatcgcttctacaaataccagtaataaaagtgacactaacgtggaacaagtttctgcc
acaaatgatactattaaacgcctagaatctaaattgttgaaaaatcaagccaagcaacag
agtgaatccggacgtttgagcttgggagcctcccgtggaagcagtgtggaaagcttgccc
ccaacctctgagggcaaaaggatgagtgctgacatgtctgaaatagaagctaggattgct
gcgaccgcagcatattccaagcctaaacgaggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccatt
caagacttgactgttactggaacagaacctggtcaggtgagcagtaggtcatccagtcct
agtgtcagaatgatcactacctcaggaccaacctcagaaaagccggctcgaagtcatcca
tggacccctgatgattccacagataccaatggatcagataactccatccctatggcctat
cttacactggatcaccaactacagcctctagcaccatgcccaaactccaaagaatctatg
gcagtgtttgaacaacattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaggaactagttgcagaattggaccaggatgaaaaggac
cagcaaaatacatctcgactggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacagctagaggtcatcagaagtcagcagcaa
aaacgacaaggcacttcatga

DBGET integrated database retrieval system