KEGG   Oryctolagus cuniculus (rabbit): 100343868
Entry
100343868         CDS       T03373                                 
Symbol
DET1
Name
(RefSeq) de-etiolated homolog 1 (Arabidopsis)
  KO
K10571  de-etiolated-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100343868 (DET1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343868 (DET1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100343868 (DET1)
SSDB
Motif
Pfam: Det1
Other DBs
NCBI-GeneID: 100343868
NCBI-ProteinID: XP_008249949
Ensembl: ENSOCUG00000017555
LinkDB
Position
Un
AA seq 550 aa
MDHHASTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAQDLLQGCGGEILSNGSDQRAVGIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFYEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTLKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFMDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPVINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDEDHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRFYARDSGLLKFEIQAGLLGRPVSHTVRRLVAFTFHPFEPFAISVQRTNAEYV
VNFHMRHCCT
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggatcaccatgcttccaccatcaaaccccgaagaatccagaaccagaatgtcattcac
cgcctggagcgccggcggatcagctcgggcaaggccggcacccactggcatcaggtgcgt
gtgttccaccagaacgtcttccccaacttcacggtggtcaacgtggagaagcctccgtgt
ttcctgcgcaagttctcgcctgacggacgctacttcatcgccttctcctcggaccagacg
tctctggagatctacgagtaccagggctgccaggcagcccaggacctgctgcaggggtgc
gggggcgagatcctgtccaacggcagcgaccagcgggcggttggcatcaggggccggctc
ttcgaacgcttttttgtcctgctgcacatcaccaatgtggccgccaacggcgagcacctg
aaccgggagtgcagcctgttcaccgacgactgccgctgtgtcatcgtgggctcggctgcc
tacctgccggacgagccccacccccccttctacgaggtgtaccgcaacagcgagtcggtg
acccccaacccgcggtccccgctggaggactactcgctgcacatcatcgacctgcacacc
ggccgtctgtgcgacacgcgcacgctcaagtgtgacaaggtggtcctgtcccacaaccag
gggctgtacctgtacaagaacatcctggccatcttgtcggtgcagcagcagaccatccat
gtcttccaggtgacccccgagggcaccttcatggatgtgcgcaccatcggccgcttctgc
tatgaggacgacctgctcaccgtgtcggccgtcttccccgaggtgcagcgcgacagccag
acgggcatggccaatcccttcagggaccctgtcatcaactccctgaagcaccgcctgctg
gtgtacctgtggcgccgggcagagcaggacggcagtgccatggccaagaggcgcttcttc
cagtacttcgaccagctgcggcagctgcgcatgtggaagatgcagctcctggacgaagac
caccttttcatcaagtacacgagtgaggacgtggtgacgctgcgggtcacagacccctcc
caggcatctttcttcgtggtgtacaacatggtgacgacggaggtcatcgcagtgtttgag
aacacgtcggatgagcttctggagctcttcgagaacttctgcgacctcttccgcaacgcc
accctgcacagcgaggtccagttcccctgctcggcttccagcaacaacttcgcaaggcag
atccagcgccggttcaaagacaccatcatcaacgccaagtacggggggcacacggaggcc
gtgcgccggctgctgggccagctccccatcagtgcccagtcctacagcggcagcccctac
ctggacctgtctctgttcagctatgacgacaagtgggtgtcagtcatggagcgccccaag
acctgtggagatcaccccatcaggttctacgcccgcgactccggcctgctcaagtttgag
atccaggcgggcctgctcggccgccccgtcagccacaccgtgcggcgcctcgttgccttc
accttccacccctttgagcctttcgccatttctgtgcagaggactaacgccgagtacgtc
gtcaacttccacatgcgacactgctgtacgtag

KEGG   Oryctolagus cuniculus (rabbit): 100352258
Entry
100352258         CDS       T03373                                 
Symbol
ERCC8
Name
(RefSeq) ERCC excision repair 8, CSA ubiquitin ligase complex subunit
  KO
K10570  DNA excision repair protein ERCC-8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03420  Nucleotide excision repair
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100352258 (ERCC8)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100352258 (ERCC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100352258 (ERCC8)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100352258 (ERCC8)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100352258 (ERCC8)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100352258 (ERCC8)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 Nup160
Other DBs
NCBI-GeneID: 100352258
NCBI-ProteinID: XP_002714099
Ensembl: ENSOCUG00000004519
UniProt: G1SLZ1
LinkDB
Position
11:complement(76930647..76998321)
AA seq 396 aa
MLGFLSARQVGLEDPVRLRRAESTRRVLGLELNKDRDVERIHGSGVNTLDIEPVEGRYML
SGGSDGVIVLYDLENSSRQPFYTCKAVCSIGRNHPDVHKYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVATRHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQHNGEKSQAVESA
NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNDSRKGLKFAVS
CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKNVDCCVFQSNFQELYSGSRDCNILA
WVPSLSEPVPDDDEAATKTQLNPAFEDAWSSSDEEG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgctggggtttttgtccgcgcgacaggtgggtttagaggaccctgttcgcctccggaga
gcagagtctacacggagggttttgggactggagttaaacaaagacagagatgttgaaaga
atccatggcagtggagttaacacccttgacattgaacctgttgaaggacgatacatgtta
tcaggtggatcagatggtgtgattgtgctttatgaccttgagaactccagcagacagcct
ttttacacctgtaaggcggtgtgttccattggcagaaaccatcctgatgttcacaaatac
agtgtggagacggtacagtggtatcctcacgatactggcatgttcacatcaagttcgttt
gacaaaactctgaaagtatgggatacaaatacattacaaactgcagatgtatttaatttt
gaggaaacagtttatagccatcacatgtctccagtcgccaccaggcattgcttggtagca
gttggtactagagggccgaaagtacaactttgtgacttaaagtcgggatcctgttctcac
attctacagggtcacagacaggaaatactggcagtttcctggtcaccacgctatgattat
atcttagcaactgcaagtgctgacagcagagtaaagttatgggatgtgaggagagcatcg
ggatgtctgattactcttgatcagcataatggggaaaagtcacaagctgttgaatcagca
aacactgctcataatgggaaagttaatggcttatgttttacaagtgatggacttcacctc
ctcactgttggtacagataatcgaatgaggctctggaatagttccaacggagaaaacaca
ctagtgaactatggaaaagtttgtaatgacagtagaaaaggattgaaattcgctgtctcc
tgcggctgcagttcagaatttgtttttgtaccatatggtagcaccattgctgtttataca
gtttactcaggagaacagataactatgcttaagggacattataaaaatgttgactgctgt
gtatttcaatctaatttccaggaactttatagtggtagcagagactgcaatattcttgct
tgggtgccatctttaagtgaaccagttccagatgatgatgaggctgcaaccaaaacacaa
ctgaatccagcgtttgaagatgcttggagcagcagtgatgaggaaggatag

KEGG   Oryctolagus cuniculus (rabbit): 100352386
Entry
100352386         CDS       T03373                                 
Symbol
DDB2
Name
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03420  Nucleotide excision repair
ocu04115  p53 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05161  Hepatitis B
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100352386 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100352386 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100352386 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352386 (DDB2)
   05202 Transcriptional misregulation in cancer
    100352386 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100352386 (DDB2)
   05212 Pancreatic cancer
    100352386 (DDB2)
   05225 Hepatocellular carcinoma
    100352386 (DDB2)
   05226 Gastric cancer
    100352386 (DDB2)
   05214 Glioma
    100352386 (DDB2)
   05216 Thyroid cancer
    100352386 (DDB2)
   05220 Chronic myeloid leukemia
    100352386 (DDB2)
   05217 Basal cell carcinoma
    100352386 (DDB2)
   05218 Melanoma
    100352386 (DDB2)
   05213 Endometrial cancer
    100352386 (DDB2)
   05224 Breast cancer
    100352386 (DDB2)
   05222 Small cell lung cancer
    100352386 (DDB2)
   05223 Non-small cell lung cancer
    100352386 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100352386 (DDB2)
   05169 Epstein-Barr virus infection
    100352386 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100352386 (DDB2)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100352386 (DDB2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100352386 (DDB2)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100352386 (DDB2)
SSDB
Motif
Pfam: WD40 NBCH_WD40 CNH
Other DBs
NCBI-GeneID: 100352386
NCBI-ProteinID: XP_002709135
Ensembl: ENSOCUG00000002076
UniProt: G1SGS2
LinkDB
Position
1:186575953..186594227
AA seq 427 aa
MAPKKRPEAQKPLEVVLRPRSKRNRSPRDPEPEAKKLNVTGCAPGRRSDSDCLPAGLPGL
QDPQPCSSLVRALHQHRLGRTAWPSLQQGLQQSFLHSLASYRIFQKAAPFDRRATSLAWH
PTHPSTLAVGSKGGDIMLWNFRVKDRPTFIKGIGAGGSITGLKFNLLNTNQFFASSMEGT
TRLQDFTGNTLRVFTSSDTCNVWFCSLDVSARSRVVVTGDNMGHVFLLNMDGKELWNLRM
HKKKVTHVALNPSCDWLLATASVDQTVKIWDLRQVRGKASFLCSLPHKHPVNSACFSPDG
ARLLTTDQKNELRIYSASQWDCPVGLIPHPHRHFQHLTPIKASWHPRYNLIVVGRYPDPN
FKSCAPYELRTIDMFDGGSGKMMCQLYDPESSGIVSLNEFNPMGDTLASTMGYHILVWSQ
EEAGARK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgccccgaagcccagaagcccctcgaggttgtgctgcgcccccgg
agcaagaggaaccgaagtccccgagacccagagcccgaggccaagaagctgaacgtcacg
ggctgcgctcctggcagaagatctgactcagactgcctcccggcggggttgcccggcctg
caggacccgcagccctgcagcagccttgtcagggccttgcaccagcacaggctgggcaga
accgcctggccatcgctgcaacagggtctccagcagtcctttttgcactctctggcttct
taccggatattccaaaaggctgccccatttgataggagggctacctccttggcctggcac
ccgactcaccccagcaccctggcagtgggttccaaagggggagacatcatgctgtggaac
tttagggtaaaggacagacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccttctcaataccaaccagtttttcgcctcctcaatggagggaaca
actaggctgcaagactttacaggcaacaccctccgagtttttaccagctcagacacctgc
aacgtgtggttttgcagcctggacgtgtctgccagaagccgagtggtggtcacaggagac
aacatggggcacgtgtttctgctgaacatggacggtaaagagctctggaatctccgaatg
cacaaaaagaaagtgacccatgtggctctgaacccgagctgcgattggttactggccaca
gcctccgtagaccaaacagtgaaaatctgggacctgcgccaggttagagggaaagccagc
ttcctctgctcgctgccacacaagcatcctgtcaactcagcctgcttcagtcctgacgga
gcccggctcctgaccacggatcagaagaatgagctccggatttactctgcctcccagtgg
gactgccccgtgggcctcatcccgcatcctcaccggcacttccagcacctcactcccatc
aaggcaagctggcaccctcggtacaacctcattgtcgtgggtcggtacccagatcctaat
ttcaaaagttgcgctccctacgaactaaggacgattgacatgtttgacggaggctcaggg
aagatgatgtgtcagctctatgacccagaatcttctgggatcgtttcgcttaacgagttc
aatcccatgggggacacactggcctccacaatgggttatcacattctcgtttggagccag
gaagaagctggggcacggaaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356568
Entry
100356568         CDS       T03373                                 
Symbol
RFWD2
Name
(RefSeq) ring finger and WD repeat domain 2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100356568 (RFWD2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100356568 (RFWD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100356568 (RFWD2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100356568 (RFWD2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100356568 (RFWD2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100356568 (RFWD2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-RING_2 zf-RING_UBOX zf-C3HC4_3 zf-rbx1 WD40_like zf-C3HC4_4 zf-RING_4 Prok-RING_4 zf_C2H2_10 DZR
Other DBs
NCBI-GeneID: 100356568
NCBI-ProteinID: XP_008262031
Ensembl: ENSOCUG00000005463
LinkDB
Position
13:complement(3092889..3302014)
AA seq 590 aa
MIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFE
EKRFKLDHSVSSTNGHRWQIFQDLLGTDQDNLDLANVNLMLELLAQKKKQLEAESHAAQL
QILMEFLKVARRNKKEQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPS
HSSIIDSTEYSQPPGFSGSSQTKKQPWYISTLASRRKRLTAHFEDLEQCYFSTRMSRISD
DSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGV
TKKIKVYEYGTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGF
TGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCV
KFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQ
LKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFD
TVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgattgaggaagcatacatgacaaaatgtggccacagcttttgctacaagtgtattcat
cagagtttggaggacaataacagatgtcccaagtgtaactatgttgtggacaatattgac
catctctatcctaatttcctggtgaatgagctcattctgaaacagaagcaaagatttgag
gaaaagaggttcaaattggaccactcagtgagtagtaccaatggccacaggtggcaaata
tttcaagatttgttgggaactgaccaagataaccttgatttggccaatgtcaacctcatg
ttggagttattagcacaaaaaaagaaacagttggaagcagaatcacatgcagcccaacta
cagatccttatggagtttctcaaggttgcaaggaggaataagaaagagcaactggaacag
atccagaaggaactgagtgttttggaagaggatattaaaagagtggaagaaatgagcggc
ttgtactctcctgtcagtgaggacagcactgtgcctcaatttgaagctccttctccatca
cacagtagtattattgattccacagaatacagccaacctccaggtttcagtggcagttct
cagacaaagaaacagccttggtatatcagcacattagcttcaagacgaaaacgactcact
gctcattttgaagacctagagcagtgttatttttctacaaggatgtctcgtatctcagat
gacagtcgaactgcaagccaactggatgaatttcaggaatgcttatccaagtttactcga
tataattcagtacgacctttggccacgttgtcatatgctagtgatctctataatggctcc
agcatagtctctagtattgaatttgaccgggattgtgactattttgcaattgctggggtt
acaaagaaaattaaagtctatgaatatggcacagtcatccaggatgcagtggacattcat
taccctgagaatgaaatgacctgcaattccaaaatcagctgtatcagttggagtagttac
cataagaatctgttagctagcagtgattatgaaggcactgttatcctatgggatggattt
acaggacagaggtcaaaagtctatcaggaacatgagaagcgatgttggagtgttgacttc
aatttgatggatcctaaactcttggcttcaggttctgatgatgcaaaagtgaagctgtgg
tctaccaatctagataactcagtggcaagcattgaggcaaaggctaatgtatgctgtgtt
aaatttagcccctcttccagataccatttggctttcggctgtgcagatcactgtgtccac
tactatgatcttcgtaacactaaacaaccaatcatggtattcaaaggacaccgaaaggct
gtctcttacgcaaagtttgtgagtggtgaagaaattgtctctgcctcaacagatagccag
ctaaaactgtggaatgtagggaaaccatactgtctacgttccttcaagggtcatatcaat
gaaaaaaactttgtaggcctcgcttccaatggagattatatcgcttgtggaagtgaaaac
aactccctctacctgtactacaaaggactttctaagactttgctaacttttaagtttgat
acagtcaaaagtgttctggacaaagaccggaaagaagatgatacaaatgaatttgttagc
gctgtttgctggagagcattgccagatggggagtccaatgtgctgattgctgctaacagt
cagggtacaattaaggtgctagagttggtatga

DBGET integrated database retrieval system