KEGG   Oryctolagus cuniculus (rabbit): 100344018
Entry
100344018         CDS       T03373                                 
Symbol
LIMK1
Name
(RefSeq) LIM domain kinase 1
  KO
K05743  LIM domain kinase 1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05135  Yersinia infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100344018 (LIMK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100344018 (LIMK1)
  09158 Development and regeneration
   04360 Axon guidance
    100344018 (LIMK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100344018 (LIMK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100344018 (LIMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100344018 (LIMK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100344018 (LIMK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   100344018 (LIMK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo APH PDZ_6 ABC1 RIO1 Haspin_kinase Pkinase_fungal PknG_TPR
Other DBs
NCBI-GeneID: 100344018
NCBI-ProteinID: XP_008247308
Ensembl: ENSOCUG00000025224
UniProt: G1TZY7
LinkDB
Position
Un
AA seq 645 aa
MTKHAWWPARQSRDLGSELPVCASCGQSICDDQYLQALSADWHSDCFRCCECSASLSHQY
YEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICRTCGTFIGDGDT
YTLVEHSKLYCGHCYYQNVVTPVIEHILPDSPGSHLPHTVTLVSIPASAHGKRGLSVSID
PPLGPPGCGTEHSHTVRVQGLDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLI
QETSRLLQLTLEHDPHDSLGHGLGPEPSPLGSPAAHTPSGEAGSSPRQKPVLRSCSIDRS
PGAGSLGSPASQHRDLGRSESLRAVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETG
EVMVMKELIRFDEDTQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLR
ALIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLA
RLMVDEKNQAEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEI
IGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFTKLEQ
WLETLHMHLAGHLPLGAQLEQLDRGFWETYRRGESGLPAHPEVPD
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgactaagcatgcctggtggccagccaggcagagccgagatctgggaagcgagctgccc
gtgtgtgcgagctgcggccagagcatctgtgacgaccagtacctccaggccctgagcgcg
gactggcattcggactgcttcaggtgctgtgaatgcagtgcctccctttcgcaccagtac
tacgagaaggatgggcagctgttctgcaagaaagactactgggcccgctacggcgaatcc
tgccacgggtgctccgagcacatcaccaaggggctggtcatggtggccggggagctgaag
tatcaccccgagtgcttcatctgtcggacgtgtgggaccttcatcggcgacggggacacc
tacacgctggtggagcactccaagctgtactgcgggcactgctactaccagaacgtggtg
acccccgtcattgaacacatcctgcccgactcccccggctcccacctgccccatacggtc
acgcttgtgtccatcccggcctcggcgcatggcaaacgtggcctctcggtgtccatcgac
ccccctctcggcccaccgggctgcggcacggagcactcccacaccgtgcgcgtccaggga
ctggacccaggctgcatgagcccagatgtgaagaactccatccacgtgggagaccggatc
ctggagatcaatggcactcccatccggaatgtgcccctggatgagattgacctgttgatc
caggaaaccagccgcctgcttcagctgacgctcgaacatgacccccacgactcgctgggc
catgggctggggcctgagcccagccccttgggctccccagctgcacacactcccagcggg
gaggcgggcagctccccccggcagaaacccgtgctgaggagctgcagcatcgacaggtcc
ccgggggccggctcactgggctcgcctgcctcccagcacagggacctgggccgctcggag
tccctgcgtgcggtctgccggccgcaccgcatcttccggccgtccgacctcatccacggc
gaggtgctgggtaaaggctgcttcggccaggccatcaaggtgacacaccgggagacgggc
gaggtgatggtgatgaaggagttgatccgcttcgatgaggacacccagaggacgttcctc
aaggaggtcaaggttatgcgctgcctggagcaccccaacgtgctcaagttcatcggggtg
ctgtacaaggacaagaggctcaacttcatcacggagtacatcaagggcggcaccctgcgg
gccctcatcaagagcatggacagccagtacccgtggagtcagagggtcagcttcgccaag
gacatcgcatcagggatggcctacctgcactccatgaatatcatccaccgggacctcaac
tcgcacaactgcctggtccgagagaacaagaacgtggtggtggccgacttcgggctggca
cggctcatggtggatgagaagaatcaggccgaggacctgcgcagcctcaagaagccggac
cgcaagaagcgctacaccgtggtgggcaacccgtactggatggcgcccgagatgatcaat
ggccgcagctacgacgagaaagtagacgtgttttcctttgggatcgtcctgtgtgagatc
atcgggcgtgtgaacgcggaccccgactacctgccccgcaccatggacttcggcctcaac
gtgcgaggcttcctagaccgctactgccccccgaactgccccccgagcttcttccccatc
actgtgcgctgctgcgacctggaccccgagaagaggccctccttcacaaagctggaacag
tggctggagaccctgcacatgcacttggcgggccacctgcccctgggcgcgcagctggag
cagctggacaggggattctgggaaacgtaccggcgcggcgagagcggactgcctgcccac
cctgaggtccctgactga

KEGG   Oryctolagus cuniculus (rabbit): 100356835
Entry
100356835         CDS       T03373                                 
Symbol
LIMK2
Name
(RefSeq) LIM domain kinase 2
  KO
K05744  LIM domain kinase 2 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100356835 (LIMK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100356835 (LIMK2)
  09158 Development and regeneration
   04360 Axon guidance
    100356835 (LIMK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356835 (LIMK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100356835 (LIMK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100356835 (LIMK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   100356835 (LIMK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo PDZ_6 PDZ_2 APH Peptidase_M50 ABC1 zf-RRN7
Other DBs
NCBI-GeneID: 100356835
NCBI-ProteinID: XP_002719747
Ensembl: ENSOCUG00000002315
UniProt: A0A5F9DMZ2
LinkDB
Position
21:3658766..3727085
AA seq 617 aa
MGSYLSVPAYFTSRDPFRCSECQDPLTNWYYEKDGKLYCHKDYWGKFGEFCHGCSLLMTG
PVMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTES
VQDQLPYSVTLISMPATTEGKRGFSVSVESACSDYATTVQVKEVNRMNISPNNRNAIHPG
DRILEINGTPVRTLHVNEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLDARLSPHMQNAG
HSHTLSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLLSRDISRSESLRCSSSC
SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMR
SLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSVDPFPWQQKVRFAKGIASGMAY
LHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRPPVEKATSKKRTLRKNDRK
KRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVK
LFWEKFVPTDCPPAFFPLAATCCKLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEE
LDHTVSVQYGLTRDSPP
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggggagttacttgtccgtcccagcgtacttcacctccagggacccgtttcggtgctcc
gagtgccaagaccccctcaccaactggtactatgagaaggatgggaagctgtactgccac
aaggactactgggggaagttcggggagttctgccacgggtgctccctgctgatgacaggg
cctgtcatggtggccggagagttcaagtaccacccagagtgctttgcgtgcatgagctgc
aaggtgatcatcgaggatggggacgcgtacgctctggtgcagcatgccaccctctactgc
gggaagtgccacaatgaggtggtgctggcccccatgtttgagaggctgtccacggaatcc
gtgcaggaccagctgccctactccgtcacgcttatctccatgccggccaccaccgagggc
aagaggggcttctccgtgtccgtggagagtgcctgctccgactacgccaccacggtgcaa
gtgaaagaggtcaaccggatgaacatcagccccaacaaccgcaacgccatccatcccggg
gaccgcatcctggagatcaacgggacccctgtccgcactctgcacgtgaacgaggtggag
gatgcgattagccagacgagccagacgcttcagctattgattgaacatgaccccgtctcc
cagcgcctggaccagctgcgactggatgcccggctctccccgcacatgcagaatgctgga
cactcgcacacactcagcaccctggacaccaaggagaacctggaggggacgctgaggaga
cgctccctgaggcgcagtaacagcatctccaagtcccctggccccagctccccaaaggag
cccctgctgctcagccgagacatcagccgctccgagtccctccgctgctccagcagctgc
tcccagcagatcttccggccgtgtgacctgatccacggggaggtcctggggaagggcttc
tttgggcaggccatcaaggtcacacacaaagccacaggcaaagtgatggtcatgaaggag
ttgattcggtgtgatgaggagacacagaagacgttcctgaccgaggtgaaagtgatgcgc
agcctggaccaccccaacgtgctcaagttcatcggcgtgctgtacaaggacaagaagctg
aacctgctcacggagtacatcgagggcggcaccctgaaggacttcctgcgcagcgtggac
ccgttcccctggcagcagaaagtcagatttgccaaaggcatcgcctccggaatggcctat
ttgcattccatgtgcatcatccaccgggatctgaactcgcacaattgcctcatcaagttg
gacaagaccgtggtggtggcagactttgggctgtcccggctgatcgtggaagagaggaaa
aggcccccagtggagaaggccacctccaagaaacggaccttgcgcaagaatgaccgcaag
aagcgctacacggtggtgggaaacccctactggatggcccccgagatgctgaacggaaag
agctacgacgagacggtggacgtcttttcttttggaatcgttctctgtgagatcatcggg
caggtgtatgcggatcccgactgcctgccccgcacactggacttcggcctcaacgtaaag
cttttctgggagaagtttgtccccacagactgccccccagccttcttccccctggctgcc
acctgctgcaaactggagcccgagagcaggccggccttctcaaagctggaggactccttc
gaggccctctccctctacctgggggagctgggcattccgctgccagcagagctggaggag
ctggaccacactgtgagcgtgcagtacggcctgacccgggactcgcctccctag

DBGET integrated database retrieval system