KEGG   Oryctolagus cuniculus (rabbit): 100344131
Entry
100344131         CDS       T03373                                 
Symbol
AP2A1
Name
(RefSeq) adaptor related protein complex 2 alpha 1 subunit
  KO
K11824  AP-2 complex subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100344131 (AP2A1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100344131 (AP2A1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100344131 (AP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100344131 (AP2A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344131 (AP2A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100344131 (AP2A1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    100344131 (AP2A1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100344131 (AP2A1)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1 PDS5
Other DBs
NCBI-GeneID: 100344131
NCBI-ProteinID: XP_008251307
Ensembl: ENSOCUG00000023153
LinkDB
Position
Un
AA seq 977 aa
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVRGRLVECLETVLNKAQEPPKSKKV
QHSNARNAALLESISLIMHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGAQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAGSALEDGRRDPSSSDINGGVEATPSAVSTPSPSADL
LGLRAAPPPAAPPAPAGAGSLLVDVFSDGPAQPSLGPTPEEAFLSELEPPAPESPMALLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQSFSPTVIHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGAPQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPLQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgccggccgtgtccaagggcgatgggatgcgggggctcgccgtattcatctccgacatc
cggaactgcaagagcaaggaggcggagattaaaaggatcaacaaggaactggccaacatt
cgctccaagttcaaaggggacaaggccttggatggctacagcaagaaaaagtacgtgtgc
aagctgctcttcatcttcctgctgggccacgacattgactttgggcacatggaggccgtg
aacctgctcagctccaacaagtacacggagaagcagataggttatctgttcatctccgtg
ctggtgaactcgaactctgagctgatccggctcatcaacaacgccatcaagaatgacctg
gccagtcgcaaccccaccttcatgtgcctggccctgcactgcatcgccaacgtgggcagc
cgagagatgggtgaggccttcgctgccgacatcccccgcatcctggtggccggggacagc
atggacagcgtgaagcagagcgcggccctgtgcctgctgcggctctacaaggcctcgcct
gacttggtgcccatgggcgagtggacggcccgcgtggtgcacctgctcaatgaccagcac
atgggcgtggtcacggccgccgtcagcctcatcacctgtctctgcaagaagaaccccgac
gacttcaagacgtgcgtctccctggctgtgtcgcgcctgagccggatcgtctcttcggcc
tccaccgacctccaggactacacgtactacttcgtcccggcgccctggctctcggtgaag
ctcctgcggctgctgcagtgctaccccccgccagaggacgcggccgtgagggggcggctg
gtggagtgcctggagacggtgctcaacaaagcccaggagccgcccaagtccaagaaggtg
cagcactcgaacgccaggaacgccgcgctcctggagagcatcagcctcatcatgcactac
gacagtgagcccaacctcctggttcgggcttgcaaccagctggggcagttcctgcagcac
cgcgagaccaacctgcgctacctggccctggagagcatgtgcacactggccagctccgag
ttctcccacgaggccgtcaagacgcacatcgacacggtcatcaacgccctcaagacggag
cgggacgtcagcgtgcggcagcgggcggccgacctcctctacgccatgtgtgaccgcagc
aacgccaagcagatcgtgtctgagatgctgcgctacctggagacggccgactacgccatc
cgcgaggagattgtgctgaaggtggccatcctggcggagaagtacgccgtggactacagc
tggtacgtggacaccatcctgaacctcatccgcatcgcgggcgactacgtgagcgaggag
gtgtggtaccgcgtgctgcagatcgtcaccaaccgcgacgacgtccagggctacgccgcc
aagaccgtctttgaggcgctgcaggccccagcctgtcacgagaacatggtgaaagtcggc
ggctacatcctcggggagttcgggaacctgattgctggggacccccgctccagcccccct
gtgcagttctccctgctgcactccaagttccacctgtgcagcgtggccacgcgggccctg
ctgctgtccacctacatcaagttcatcaacctcttccccgagaccaaggccaccatccag
ggcgtgctgcgggccggcgcccagctgcgcaacgccgacgtggagctgcagcagcgcgcc
gtggagtacctcaccctcagctccgtggccagcaccgacgtcctggccacggtgctggag
gagatgccgcccttccccgagcgggagtcgtccatcctggccaagctgaagcgcaagaaa
gggcctggggccggcagcgccctggaggacggccggagggaccccagcagcagcgacatc
aacggcggtgtggaggccacgcccagcgccgtgtccacgccctcgccctctgccgacctc
ctggggctgcgggcagcccctcccccagcggcacccccggcacctgcaggggcagggagc
ctcctggtggacgtcttctccgatggccccgcccagcccagcctagggcccacccccgag
gaggccttcctcagcgagctggagccgcctgcccctgagagccccatggctttgctggct
gacccagctccagctgctgacccaggtcctgaggacatcggccctcccatcccggaagcc
gatgaactgctgaataagttcgtgtgcaagaacaacggggtcttgtttgagaaccagctg
ctgcagatcggagtcaagtccgagttccggcagaacctgggccgcatgtacctgttctac
ggcaacaagacctctgtgcagttccagagcttctcgcccaccgtcatccacccgggagac
ctccagacccagctggccgttcagaccaagcgcgtggcagcgcaggtggacggtggggcg
caggtgcagcaggtgctcaacatcgagtgtctgcgggacttcctgacgccccccttgctg
tccgtgcgtttccgctatgggggcgccccccagtccctcaccttgaagctcccggtgacc
atcaacaagttcttccagcccacagagatggcggcccaggacttcttccagcgctggaag
cagctgagcctgcccttacaggaggctcagaagatcttcaaagccaaccaccccatggat
gcggaagttaccaaggccaagcttctggggttcggctctgccctcctggacaatgtggac
cccaaccccgagaacttcgtgggcgccggaatcatccagactaaggccctgcaggtgggc
tgtctgctccggttggagcccaacgcgcaggctcagatgtaccgcctgaccctgcgcacc
agcaaggagcccgtctcccgccacctgtgcgagctgctggcccagcagttctga

KEGG   Oryctolagus cuniculus (rabbit): 100347007
Entry
100347007         CDS       T03373                                 
Symbol
AP2B1
Name
(RefSeq) adaptor related protein complex 2 beta 1 subunit
  KO
K11825  AP-2 complex subunit beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347007 (AP2B1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100347007 (AP2B1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100347007 (AP2B1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100347007 (AP2B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347007 (AP2B1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    100347007 (AP2B1)
SSDB
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm PDS5 Cnd3 RTP1_C1 TIP120 Arm_2 API5 Sec7_N
Other DBs
NCBI-GeneID: 100347007
NCBI-ProteinID: XP_002719287
Ensembl: ENSOCUG00000004060
UniProt: A0A5F9C4A7
LinkDB
Position
19:24631234..24784270
AA seq 937 aa
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTASNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKA
KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL
AELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2814 nt   +upstreamnt  +downstreamnt
atgactgactccaagtactttacaaccaataaaaaaggagaaatctttgaattaaaagct
gaactcaacaatgagaagaaagaaaagaggaaagaggctgtgaagaaggtgattgccgct
atgaccgtggggaaggatgttagctctctctttccagatgtagtgaactgcatgcagact
gacaacttggaactaaaaaagcttgtgtatctctacttgatgaattacgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggactgtgaagatcccaatcct
ttgattcgggccttggcagtcagaactatgggctgcatccgagtagacaagatcacagag
tatctctgtgaacccctccgcaagtgcttgaaggatgaagatccctatgttcgaaaaaca
gcagcagtctgtgtggcaaaactccatgacatcaatgcccagatggtggaagatcaagga
tttctggattctctacgggatctcatagcagattcaaatccaatggtggtggctaatgct
gtagcagcattatctgaaatcagtgagtctcacccaaacagcaacttacttgatctgaac
cctcagaacattaataagctcctgacagccctgaatgagtgcaccgaatggggccagatt
ttcatcttggactgcctgtctaattacaacccgaaagatgaccgggaggctcagagcatc
tgtgagcgggtaactcctcggctgtcccatgccaattctgcagtggtgctttcagcggtc
aaagtcctaatgaagtttctagagttgttacccaaggactctgattactacaatatgctg
ctgaagaagttagcccctccgcttgtcactttactctctggagagccagaagtgcagtat
gtcgccctgaggaacatcaacctcattgtccagaaaaggcctgaaatcttgaagcaagaa
atcaaagtcttctttgtgaagtacaacgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatcccaagccaatattgctcaggttctggcagagctgaaagaa
tatgccacagaggtggatgttgacttcgttcgaaaagctgtgcgggccattggacgatgt
gccatcaaggtggagcaatcagcagagcgctgtgtcagcacgttgcttgatctaatccag
accaaagtaaattatgtggtccaagaggcgattgttgtcatcagggacatcttccgcaaa
taccctaacaagtatgaaagtatcatcgccactctgtgtgagaacttagactccctggat
gaaccagatgctcgagcggctatgatctggattgtaggagaatatgctgagagaattgac
aatgcagatgagttactggagagcttcctggagggttttcatgatgagagcacccaggtg
cagcttactctgcttactgccatagtgaagctgtttcttaagaaaccatcagaaacacaa
gagttggtccagcaggttttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaacggaccctgttacagccaaagaagta
gttttgtctgagaagccactgatctctgaggagacagaccttattgagccaactctgctt
gatgagctaatttgccacattggttctttagcctctgtgtaccataaacctcccaatgct
tttgtggaaggcagtcatggaattcatcgcaaacacttgccaattcatcatgggagcact
gatgcaggtgacagtcctgttggcaccacaactgcaagtaacctggaacagccgcaggtt
atcccctctcaaggtgaccttctgggggatcttttaaaccttgaccttggtcctcctgtc
aatgtgccacaagtgtcttccatgcagatgggagcagtagacctcttgggaggaggacta
gatagtctggtgggacaatctttcatcccctcatcagtgcctgcaacctttgctccttca
cctactcctgctgtggtcagcagtggtctgaatgacctgtttgaactctccacagggata
ggcatggcacctggtggatatgtggctcctaaggctgtctggctacctgcagtaaaggct
aaagggttggagatttcaggaacatttactcaccgccaagggcacatctatatggaaatg
aacttcaccaataaagctctgcagcatatgacagactttgcaatccagtttaacaagaat
agctttggtgtcattcccagcactccactggccattcatacaccactgatgccaaaccag
agcattgatgtctccctgcctctcaacactttgggtccagtcatgaagatggagcctctg
aacaacctgcaggttgctgtgaaaaacaatattgatgttttctacttcagctgcctcatc
ccactcaatgtgctttttgtagaagatggcaaaatggaacgccaggtgttccttgcaaca
tggaaggatattcccaatgaaaatgaacttcagtttcagattaaggaatgtcatttaaat
gctgacactgtttccagcaagttgcagaacaacaatgtttataccattgccaagaggaat
gtggaagggcaggacatgctgtaccaatccctgaagctcactaatggcatttggattttg
gctgaactacgtatccagcctggaaaccccaattatacgctgtcactgaagtgcagagct
cctgaagtctctcagtacatctatcaggtctatgacagcattttgaaaaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100350578
Entry
100350578         CDS       T03373                                 
Symbol
AP2M1
Name
(RefSeq) adaptor related protein complex 2 mu 1 subunit
  KO
K11826  AP-2 complex subunit mu-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350578 (AP2M1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100350578 (AP2M1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100350578 (AP2M1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100350578 (AP2M1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350578 (AP2M1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    100350578 (AP2M1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Other DBs
NCBI-GeneID: 100350578
NCBI-ProteinID: XP_002716532
Ensembl: ENSOCUG00000004556
UniProt: G1SM15
LinkDB
Position
14:complement(81523473..81532471)
AA seq 435 aa
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgatcggaggcttattcatctataatcacaagggggaggtgctcatctcccgggtctac
cgagatgacatcgggaggaatgcagtggacgccttccgggtcaatgttatccacgcccgg
cagcaggtgcgcagccccgtcaccaacattgctcgcaccagcttcttccatgttaagcgt
tccaacatctggctggcagctgtcaccaagcagaatgtcaacgctgccatggtcttcgaa
ttcctctataagatgtgtgacgtaatggctgcctactttggcaagatcagcgaagaaaac
atcaagaacaattttgtgctcatatacgagctgctggatgagatcctggactttggctac
ccacagaactctgagacaggcgctctgaaaaccttcattacccagcagggcatcaagagt
cagcatcagacaaaagaagaacagtcccagatcaccagccaggtgactgggcagatcggc
tggcggcgagaaggcatcaagtatcgccggaatgagctcttcttggatgtgctggagagt
gtgaacctactgatgtccccacaggggcaggtgctgagtgcccatgtgtccggccgggtg
gtgatgaagagctacctgagtggcatgcccgagtgcaagtttgggatgaatgacaagatt
gtaattgaaaagcaaggcaaaggcacagctgatgaaacaagcaagagcgggaagcaatca
attgccattgatgactgcaccttccaccagtgtgtgcgactcagcaagtttgactctgaa
cgcagcatcagcttcatcccaccagatggagagtttgagctcatgaggtatcgcaccacc
aaggacatcatccttccttttcgggtgattccgctggtacgggaagtgggacgcaccaaa
ctggaggtaaaggtggtcatcaagtccaacttcaagccctcactgctggctcagaaaatt
gaggtgcggattccaaccccactgaacacaagtggtgtgcaggtgatctgcatgaagggg
aaggccaagtataaggccagtgagaacgccatcgtatggaagatcaagcgcatggcaggc
atgaaggaatcgcagatcagcgcagagattgagcttctgcccaccaatgacaagaaaaaa
tgggcccgacctcctatttccatgaattttgaggtgccatttgcgccttctggcctcaag
gtgcgctacttgaaggtgtttgaaccgaagctgaactacagcgaccacgacgtcatcaaa
tgggtgcgctacattggccgcagcggcatttacgagacccgctgctag

KEGG   Oryctolagus cuniculus (rabbit): 103345727
Entry
103345727         CDS       T03373                                 
Symbol
AP2S1
Name
(RefSeq) adaptor related protein complex 2 sigma 1 subunit
  KO
K11827  AP-2 complex subunit sigma-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103345727 (AP2S1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103345727 (AP2S1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    103345727 (AP2S1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    103345727 (AP2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103345727 (AP2S1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    103345727 (AP2S1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 103345727
NCBI-ProteinID: XP_017194320
LinkDB
Position
Un
AA seq 142 aa
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatccgcttcatcctcatccagaaccgggcgggcaagacgcgcctggccaagtggtac
atgcagttcgacgacgacgagaagcagaagctgatcgaggaggtgcacgccgtggtcacc
gtgcgcgacgccaagcacaccaacttcgtggagttccgcaacttcaagatcatctaccgg
cgctacgccggcctctacttctgcatctgcgtggacgtcaacgacaacaacctggcctac
ctggaggccatccacaacttcgtggaggtcttaaacgagtatttccataacgtctgtgaa
ctggacctggtgttcaacttctacaaggtctacacggtggtggacgagatgttcctggcg
ggcgagatccgcgagacgagccagaccaaggtgctgaagcagctgctgatgctgcagtcg
ctggagtga

KEGG   Oryctolagus cuniculus (rabbit): 103347267
Entry
103347267         CDS       T03373                                 
Name
(RefSeq) AP-2 complex subunit alpha-2
  KO
K11824  AP-2 complex subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103347267
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103347267
  09156 Nervous system
   04721 Synaptic vesicle cycle
    103347267
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    103347267
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103347267
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    103347267
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    103347267
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103347267
SSDB
Motif
Pfam: Alpha_adaptin_C Adaptin_N Alpha_adaptinC2
Other DBs
NCBI-GeneID: 103347267
NCBI-ProteinID: XP_008251972
LinkDB
Position
Un
AA seq 532 aa
MLSYLETADYSIREEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQI
VINRDDVQGYAAKTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFNLLHS
KFHLCSVPTRALLLSTYIKFVNLFPEVKATIQDVLRSDSQLRNADVELQQRAVEYLRLST
VASTDILATVLEEMPPFPERESSILAKLKKKKGPGTVTDLEETKRERSVDVNGGPEPAPA
SGSAASTPSPSADLLGLGAAPPAPVGPPPSSGSGGLLVDVFSDSASAAAPLAPGSEDNFA
RFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLSFTPTLICSDSLQSEL
NLQTKPVDPTVDGGAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNLSVKLPVTLNKFF
QPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPAN
FVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSREAVSQRLCELLSEQF
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgctgagctacctggagacggccgactactccatccgagaggagatcgtgctgaaggtg
gccatcctggccgagaagtacgccgtggactacacgtggtacgtggacaccatcctgaac
ctgatccgcatcgcgggcgactacgtgagtgaggaggtgtggtaccgcgtcatccagatc
gtcatcaaccgcgacgacgtgcagggctacgccgccaagaccgtgttcgaggccctgcag
gccccggcgtgccacgagaacctggtcaaagtgggcggctacatcctgggggagttcgga
aacctgatcgctggggaccccagatccagccccctgatccagttcaacctgctgcactcc
aagttccacctgtgcagcgtccccacgcgagcgctgctgctgtccacctacatcaagttc
gtgaacctcttcccggaggtcaaggccaccatccaggacgtgctgcgcagcgacagccag
ctgcggaacgccgacgtggagctgcagcagcgggccgtggagtacctgcggctcagcact
gtggccagcaccgacatcctggcgacggtcttggaggagatgcccccgttccccgagcgg
gagtcctccatcctggccaagctgaagaagaagaaaggccccggcacggtgacagacctg
gaggagaccaagcgggagaggagcgtggacgtgaacgggggccctgagcccgccccggcc
agcggcagcgctgcgtctacgccttcgccatcggcagacctgctgggtctgggggccgcg
cctccggcccctgtgggcccccccccctcctctggcagcggcgggctgctcgttgacgtg
ttttcagactcggcttctgcggctgctcctctggctcctggctccgaggacaactttgcc
aggtttgtgtgtaaaaataatggtgtattgtttgaaaatcagctgcttcaaattggactt
aagtctgagtttcggcagaatttaggtcggatgttcatcttctacggcaacaagacctcc
acccagttcctcagttttactccaacactaatctgctcagacagcctgcagtctgagctg
aacctgcagaccaagcccgtggacccgacggtggacgggggcgcccaggtgcagcaggtg
gtcaacatcgagtgtgtgtctgacttcacagaggcgccggtgctcaacatccagttcagg
tacgggggcacgtttcagaacctgtccgttaagctgcccgtcaccctcaacaagtttttc
cagcccacagaaatggcttctcaggatttctttcagcgctggaagcagctgagcaaccca
cagcaggaggtgcagaacatcttcaaagccaagcatcccatggacacggagatcactaaa
gcaaagatcattgggtttggttctgcactccttgaagaagtcgatcctaatcctgccaac
ttcgtgggagctgggatcatccacaccaaaactacccagatcggatgcttgcttcgcttg
gagccgaatctgcaggcccagatgtaccgactcacgctgcggacgagcagagaggccgtc
tcccagaggctgtgtgagttgctgtcggagcagttctag

DBGET integrated database retrieval system