KEGG   Oryctolagus cuniculus (rabbit): 100344172
Entry
100344172         CDS       T03373                                 
Symbol
IL21
Name
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344172 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344172 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100344172 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100344172 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100344172 (IL21)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100344172 (IL21)
SSDB
Motif
Pfam: IL15 IL4
Other DBs
NCBI-GeneID: 100344172
NCBI-ProteinID: XP_008266192
Ensembl: ENSOCUG00000015304
LinkDB
Position
15:complement(98465662..98472798)
AA seq 150 aa
MERIVICLMVIFLGTVAHKSSSKGQDRYMIRMHQLLDIVDQLQSDVNDLDPDFLPAPQDV
QKGCEQSAFSCFQKAQLKPANAGDNGKRISSLIKQLKRKLPSTKSKKTQKHRPTCPSCYS
YEKKNLKEFLERLKSLIQKMIHQHLLEHLR
NT seq 453 nt   +upstreamnt  +downstreamnt
atggaaaggatagtcatctgtctgatggtcatcttcttggggacagtggcccataaatca
agctccaaagggcaagatcgttacatgattagaatgcatcaacttttagatattgttgat
cagctgcaaagtgatgtgaatgacttggaccctgattttctacctgctccacaagatgta
cagaaaggctgtgagcagtcagctttttcatgttttcagaaggcccaactcaagccagca
aatgcaggagacaatggaaagagaataagctcattaattaaacagctgaagaggaaacta
cctagcacaaagtcaaagaaaacacagaaacacagaccaacatgtccttcgtgttattca
tatgagaaaaaaaaccttaaagaattcctagaaagactgaaatcacttattcaaaagatg
attcatcagcatctccttgaacacctgagataa

DBGET integrated database retrieval system