KEGG   Oryctolagus cuniculus (rabbit): 100344245
Entry
100344245         CDS       T03373                                 
Symbol
ROBO1
Name
(RefSeq) roundabout guidance receptor 1
  KO
K06753  roundabout, axon guidance receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100344245 (ROBO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ocu04515]
    100344245 (ROBO1)
Cell adhesion molecules [BR:ocu04515]
 Immunoglobulin superfamily
  ROBO family
   100344245 (ROBO1)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set C2-set_2 Ig_5 Pur_ac_phosph_N Big_4
Other DBs
NCBI-GeneID: 100344245
NCBI-ProteinID: XP_002716693
Ensembl: ENSOCUG00000002537
LinkDB
Position
14:137720770..138960874
AA seq 1612 aa
MIAEPAHFYLFGFICLCSGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTI
EWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSH
NASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGIPLDDKDERIT
IRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSA
EFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKA
EASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPP
QSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQ
GPVNQTVAVDGTLVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLETGMLQIRYAKLGD
TGRYTCTASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTL
LWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETFAIKGLKPNAIYLFLVRAANA
YGISDPSQISDPVKTQDVPPTSQGVDHKQVQRELGNVVLHLHNPTILSSSSIEVHWTVDQ
QSQYIQGYNILYRPSGASHGDTDWSVFEVRTPTKNSVVIPDLKKGVNYEIKARPFFNEFQ
GADSEIKFAKTLEEAPSAPPQSVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLG
NETRYHINKTVDGSTFSVVIPSLVPGIRYSVEVAASTGAGPGVKSEPQFIQLDSHGNPVS
PEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSVWLYRHRKKRNGLTSTYAGIRKVP
SFTFTPTVTYQRGGDAVSSGGRPGLLNISEPATQPWLADTWPNTGNNHSDCSINCCTAGN
GNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLK
DGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPPAQQKQEVAPVQYNIMEQ
NKLNKDYRANDTIPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGG
MNWADLLPPPPAHPPPHSNSEEYSVSVDESYDQEMPCPVPPARMYLQQDELEEEEDERGP
TPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEEIGHMQHQPDRRRQPVSPP
PPPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVTKMQTRRLLLRGLEQTPASSV
GDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVA
RRQMQDASGRRHFHASQCPRPTSPVSTDSNVSAAVMQKARPAKKQKHQPGHLRREAYTDD
LPPPPVPPPAIKSPTVQSKAQLEVRPVMVPKLPSVEARADRSSDRKGGSYKGREVLDGRQ
VADMRTNPGDPREAQEQQNDGKGRGNKGAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPR
DPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES
NT seq 4839 nt   +upstreamnt  +downstreamnt
atgatcgcggagcccgctcacttttacctctttggattcatatgtctctgttcaggctcc
cgtcttcgtcaggaagattttccacctcgcattgttgaacacccttctgacctaatcgtc
tcaaaaggagaacctgccactctgaactgtaaagcagaaggccgccccacccccaccatt
gaatggtacaaaggcggggagagagtggagacagacaaggatgaccctcgctcccaccgg
atgttgctgccaagtggatctttatttttcttgcgcatcgtgcatggacgaaaaagtagg
cccgatgaaggtgtctacgtctgtgtagcaaggaattacctcggagaggctgtgagccac
aatgcatcgctggaggtagctatactacgggatgacttcagacaaaacccttccgatgtc
atggtggcagtaggggagcctgcagtaatggaatgccaacctccaagaggccatcctgaa
cctaccatctcgtggaagaaagacggcattcccctggacgacaaggatgaacggataact
atacgaggaggaaagctcatgatcacgtacacccgtaaaagcgatgctggcaagtatgtc
tgtgttgggaccaacatggttggagaacgcgaaagtgaagtagcagagctaactgtttta
gagagaccatcatttgtgaagagacctagtaacttagcagtaacagtggatgacagtgca
gaatttaaatgtgaggcccgaggtgaccctgtgcctacagtacgatggagaaaagatgat
ggagagctgcccaaatccagatatgaaatccgagatgatcataccttgaaaattcggaag
gtgacggctggtgacatgggatcatatacctgtgttgcagaaaatatggtcggaaaagct
gaagcttcagctactctgactgttcaagagcctccacattttgtggtgaaaccccgagac
caggttgttgccttgggacgaactgtgacttttcagtgtgaagcaaccggaaaccctcaa
ccagctattttttggaggagagaggggagtcagaatctgctcttctcatatcagccacca
cagtcatctagccggttttcagtctcccagactggtgacctcactattactaatgtccag
cgatctgatgttggttattatatctgccagactctaaatgttgccggaagtatcatcaca
aaagcatatttggaagttactgatgtgattgcggaccggcctcccccagtcattcgccaa
ggtcctgtgaatcagactgttgccgtggatggtactttagtcctcagctgtgtggccaca
ggcagtccagtcccaacaattctgtggagaaaggatggagtccttgtttccacccaagat
tctcgaatcaaacagctggagaccggaatgctgcagatccgatatgctaagctgggtgac
actggtcggtacacctgcaccgcatcaacccccagtggtgaagcgacatggagtgcttac
attgaagtccaagaatttggcgttccagttcagcctccgagacccactgaccccaattta
atccccagtgccccctcaaaacctgaagttacagatgtcagcagaaatacagtaacatta
ttgtggcaaccaaatttgaattcaggagcaacccctacatcttatattatagaagccttc
agccatgcgtctggtagcagctggcagaccgtagcagagaatgtgaaaacagaaacattt
gccattaaaggactcaaacctaatgccatttaccttttccttgtgagggcagctaacgca
tatggaattagtgatccaagccaaatatctgatccagtgaaaacacaagatgttccccca
acaagtcagggggtggaccacaagcaggtccagcgagaactcggaaatgttgtcctgcac
ctccacaaccctaccatcctctcctcctcttccatcgaagtgcactggacggtggaccag
cagtctcagtatatccaaggctacaacatcctctaccggccttcaggagccagccatgga
gatacagactggtcggtgtttgaagtgaggaccccaaccaaaaatagtgtggttatccct
gatctcaaaaagggagtcaactatgaaattaaggctcgtcccttttttaacgaatttcaa
ggagcagatagtgaaatcaagtttgccaaaaccctggaagaagcacccagcgccccaccg
caaagcgtgactgtgtcaaagaacgatggaaacggaactgccattcttgtcagttggcag
ccccctcctgaagacactcagaatggaatggtccaagagtacaaggtttggtgtctgggc
aatgaaacacgataccatataaacaagacggtagatggatccacgttttctgtggtcatt
ccctctctggtccctggcatccgatacagcgtggaagtggcagccagcactggcgctgga
cctggggtgaagagcgagccacagttcatccagttagattctcacggaaacccggtgtcc
cctgaggaccaggtcagcctcgcgcagcagatctcagacgtggtgaagcagccagcattc
atcgcgggcatcggggctgcctgctggatcatcctcatggtcttcagcgtctggctttac
cggcatcgcaagaagaggaatggactcaccagcacctacgcaggcatcaggaaagtcccg
tcttttaccttcacaccaacagtaacttatcagagaggaggagacgctgtgagcagtgga
gggaggcctggattgctcaacatcagtgaacctgccacacagccatggctggcagacacg
tggccaaacaccggcaacaaccacagcgactgctccatcaactgctgcacggcaggcaac
gggaatagcgacagcaacctgacaacctacagtcgcccagctgattgtatagccaattat
aacaaccaactggataacaaacaaacaaatctgatgctccctgagtcaactgtttatggt
gatgtggaccttagtaacaaaatcaatgagatgaaaaccttcaatagcccaaatctgaag
gacgggcgttttgtcaatccatcagggcagcccacaccttacgccaccacccagctcatc
cagtcaaacctcagcaataacatgaacaacggcagcggggactctggcgagaagcactgg
aaaccacctgctcagcagaaacaagaggtggcaccggttcagtataacatcatggagcag
aacaagctgaacaaagattatcgagcaaatgatacaattcctccaactatcccttacaac
caatcgtatgaccagaatacaggaggatcctataacagttcagaccggggcagcagtaca
tctgggagtcaagggcacaagaaaggggcacggacacccaaagtaccaaaacagggtggc
atgaactgggcggacctgcttccccctcctccagcacacccccctccacacagcaatagt
gaagagtacagtgtctctgtagatgaaagctatgaccaagagatgccatgccctgtaccc
ccagcaaggatgtatttgcaacaagatgaattggaagaagaggaagatgaaagaggcccc
actccccctgtacggggagcagcttcctctccagcagctgtgtcctatagccatcagtcc
actgccactctgaccccttccccgcaagaggaactccagcccatgctacaggactgccca
gaagagattggccacatgcagcaccaacctgacaggagacgacagcctgtgagtcctcct
cctcccccacggccgatatccccaccacacacctatggctacatttctggaccccttgtc
tcagatatggatacggatgcaccagaagaggaagaagatgaagccgacatggaagtcacc
aagatgcaaaccagaaggcttttgttacgtggtcttgagcagacccctgcctcaagtgtt
ggggacctcgagagctctgtcactggctccatgatcaatggctggggttcagcgtccgag
gaggacaacatatccagcgggcgctccagcgttagttcttccgacggctcctttttcacg
gatgctgatttcgcccaggcagtcgcagcggcagcagagtatgctggtctaaaagtggca
cgccgtcaaatgcaagacgcgagcggccgccgacattttcacgcatctcaatgcccgcgg
cctaccagtcctgtgtctaccgacagcaacgtgagtgctgctgtaatgcagaaagccaga
ccagccaagaaacagaaacaccagccaggacatctgcgcagagaagcctacacagatgat
cttccacctcctccagtgccaccacctgctataaagtcacccactgtccaatccaaggca
caactggaggtacgacctgtaatggtgccaaaactcccttctgtagaagcaagagcagac
agatcgtcagatagaaaaggaggcagctacaaggggagagaagtgttggatggaagacaa
gtggctgatatgcgaacaaatccaggggatcccagagaagcacaggaacagcagaatgat
gggaaaggacgaggaaacaagggagcaaaacgagatcttccaccagcaaagactcatctc
atccaagaggatattctaccatactgtagacctacatttccaacatcgaataatcctaga
gatccaagttcctcaagctcaatgtcatcaagaggatcaggaagcagacaaagagaacaa
gcaaatgtaggtcgaagaaatattgcagaaatgcaagtacttggaggatatgaaagagga
gaagataataatgaagaattagaggaaacagaaagctga

DBGET integrated database retrieval system