KEGG   Oryctolagus cuniculus (rabbit): 100344455
Entry
100344455         CDS       T03373                                 
Symbol
LRRC4C
Name
(RefSeq) leucine rich repeat containing 4C
  KO
K07523  netrin-G1 ligand
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100344455 (LRRC4C)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100344455 (LRRC4C)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig V-set LRR_9 Ig_2 LRR_1 LRRNT Ig_6 Herpes_gE_N Syndecan
Other DBs
NCBI-GeneID: 100344455
NCBI-ProteinID: XP_008268090
Ensembl: ENSOCUG00000017587
UniProt: G1TE00
LinkDB
Position
1:complement(179554266..179741263)
AA seq 640 aa
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgttgaacaagatgaccttacatccacagcagataatgataggtcctaggtttaacagg
gccctatttgaccctctgcttgtggtgctgctggctcttcaacttctcgtggtggctggt
cttgtacgggctcaaacctgcccttccgtgtgctcctgcagtaaccaattcagcaaagta
atttgtgttcggaaaaaccttcgcgaggttccggatggcatttccaccaacacacgactg
ctgaacctccatgagaaccaaatccagatcatcaaagtgaatagcttcaagcacttgagg
cacctagaaattctacagttgagcagaaaccacattagaaccattgaaattggggccttc
aatggtctggcgaacctcaacactctggaactcttcgacaatcgtcttaccaccatccca
aatggagcttttgtatatttgtctaaactgaaggagctttggttgagaaacaaccccatt
gaaagcatcccttcttatgcttttaacagaataccttctttgcgccgactagacttaggg
gaattaaaaaggctttcatacatctcagaaggtgcctttgaaggtctgtccaacttgaga
tatttgaaccttgccatgtgcaaccttcgggaaatccctaacctcacaccgctcataaaa
ctagatgagctagatctttctgggaatcatttgtctgccatcaggcctggctctttccag
ggattgatgcaccttcaaaaactgtggatgatacagtcccagattcaagtgattgaacgg
aatgcctttgataaccttcagtcactagtagagatcaacctggcacacaacaatctaaca
ttactgcctcatgacctctttacaccgttgcatcatctagagcggatacacttacatcac
aacccttggaactgtaactgtgacatactgtggctcagctggtggataaaagacatggct
ccctccaacacagcttgttgtgcccggtgtaacactcctcccaatctgaaagggaggtac
attggggaactagaccagaattacttcacatgctatgctcctgtgattgtggagccccct
gcagacctcaatgtcactgaaggcatggcagctgagctgaaatgtcgggcctccacgtcc
ctgacgtctgtatcttggattactccaaatggaacagtcatgacacatggggcatataaa
gtgcggatagctgtgctcagtgatggtacgttaaattttacgaatgtaacagtgcaagat
acaggcatgtacacgtgtatggtgagtaattctgttggaaacactactgcttcagccact
ctgaatgttactgcagcgaccactactcccttctcttacttttcaactgtcacagtagag
actatggaaccttctcaggatgaggcacggaccacagataacaatgtgggccccactcca
gtgattgattgggaaaccaccaatgtgaccacttctctcacgccacagagcacaaggtcg
acagaaaagacattcaccatcccagtgactgatataaacagtgggattccaggaattgat
gaagtcatgaagactactaaaatcatcattgggtgttttgtggccataacactcatggct
gcagtgatgttggtcattttctacaagatgaggaagcagcaccatcggcaaaatcatcat
gctccaacaaggactgttgaaatcatcaatgtggatgatgagattacaggggacacaccc
atggagagccacctgcccatgcctgctattgagcatgagcacttaaatcactataactct
tacaaatctcccttcaaccacacaacaacagttaacacaataaattcaatacacagttca
gtgcatgaaccgttattgatccgaatgaactctaaagacaatgtacaagagactcagatc
taa

DBGET integrated database retrieval system