KEGG   Oryctolagus cuniculus (rabbit): 100344510
Entry
100344510         CDS       T03373                                 
Symbol
PPIL2
Name
(RefSeq) peptidylprolyl isomerase like 2
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100344510 (PPIL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ocu03041]
    100344510 (PPIL2)
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100344510 (PPIL2)
   04121 Ubiquitin system [BR:ocu04121]
    100344510 (PPIL2)
Enzymes [BR:ocu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100344510 (PPIL2)
Spliceosome [BR:ocu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    100344510 (PPIL2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    100344510 (PPIL2)
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome associated proteins
    100344510 (PPIL2)
Chaperones and folding catalysts [BR:ocu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100344510 (PPIL2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  U-box type E3
   100344510 (PPIL2)
SSDB
Motif
Pfam: Pro_isomerase Rtf2 U-box zf-NOSIP Ribosomal_S6
Other DBs
NCBI-GeneID: 100344510
NCBI-ProteinID: XP_002719769
Ensembl: ENSOCUG00000022906
UniProt: G1TN22
LinkDB
Position
21:5536942..5556126
AA seq 522 aa
MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQSNFRRLPFDHCSLSLQPFVYPVCTPEGVV
FDLLNIVPWLKKYGTNPSTGEKLDGRSLIKLNFAKNSEGKYHCPVLFTVFTNNTHIVAVR
TTGNVFAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFFHVKNNIK
IVDPDEEKARQDPCYYLKNTNAETRETLQELYKEFRGDEVLAATTRVPEKQKVDKLNAAH
YSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYRFVKKKGYVRLHTNKGDLNLELHCDLT
PKTCENFIKLCKKQYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDELRPNLSH
TGRGILSMANSGPNSNKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTAMENVESDPKTD
RPKEDVRIEAATVFVDPYEEADAQIAEERKKTQLEAAPEAPAKAPQPQAGSQGPQTYRQG
VGKYINPAATKRAAEEEPAASAAAPVPKKQAGRGGFGDFSSW
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggggaaacgccagcaccagaaagacaagatgtacatcacctgtgctgaatacactcac
ttctatggtggcaagaagccagatctcccccagtcaaatttccgccgtttacccttcgac
cactgcagtctctctctacagcccttcgtctacccagtctgcaccccggaaggcgtcgtc
tttgacttactgaacatagttccgtggcttaagaagtacgggaccaaccccagcactgga
gagaaactcgacgggcggtccctgatcaagctgaacttcgccaagaacagtgaggggaag
taccactgcccggtgctgtttaccgtgttcaccaacaacacccacatcgtggctgtcagg
accacgggcaacgtcttcgcctacgaggctgtggagcagctgaacatcaaggctaagaac
ttccgggacctgctgaccgacgagcccttctcccggcaggacatcatcaccctgcaggac
cccaccaatctggacaagttcaacgtctccaacttcttccacgtcaagaataacataaag
atagtagacccagatgaggaaaaggccagacaggacccgtgttactatttgaaaaacacc
aacgccgagacgcgcgagacgctgcaggagctgtacaaggagttcagaggggacgaggtc
ctggccgccaccacgagagtccctgagaagcagaaagtagacaagctgaatgccgcccac
tattccacagggaaggtcagcgcctccttcacctccaccgccatggttcccgaaaccaca
cacgaagcagcggccatcgacgaggacgtgctgcgctaccggtttgtgaagaagaagggc
tacgtgcggctgcacaccaacaagggcgacctcaacctggagctgcactgcgacctgacc
cccaaaacctgcgagaacttcatcaagctgtgcaagaagcagtactacgacggcaccatc
ttccacaggtccatcaggaacttcgtgatccaagggggcgaccccaccggcacgggcaca
ggtggggagtcgtactgggggaagccgttcaaagacgagctccggcccaacctctcgcac
accggccgcggcatcctcagcatggccaactcggggcccaacagcaacaagtcgcagttc
ttcatcaccttccgctcctgcgcttacctggacaagaagcacaccatctttggacgggtg
gtcggcggcttcgacacgctgacggccatggagaacgtggagagcgaccccaaaactgac
cgccccaaggaggatgtgcgcatcgaagccgccactgtgttcgtggacccctatgaggag
gctgacgcccagatcgctgaggagcggaagaagacccagctggaggcagccccggaggca
ccggccaaggccccccagccccaggcggggagccagggcccccagacctaccgccagggg
gtcggcaagtacatcaacccggctgccacgaaacgggcggcggaggaggagccggcagcc
agcgccgccgcgcccgtgcccaagaagcaggcgggccgtggtggcttcggggacttcagc
tcctggtag

DBGET integrated database retrieval system