KEGG   Oryctolagus cuniculus (rabbit): 100344921
Entry
100344921         CDS       T03373                                 
Symbol
EFNA1
Name
(RefSeq) ephrin A1
  KO
K05462  ephrin-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100344921 (EFNA1)
   04014 Ras signaling pathway
    100344921 (EFNA1)
   04015 Rap1 signaling pathway
    100344921 (EFNA1)
   04151 PI3K-Akt signaling pathway
    100344921 (EFNA1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100344921 (EFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100344921 (EFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100344921 (EFNA1)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100344921 (EFNA1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100344921 (EFNA1)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100344921 (EFNA1)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100344921 (EFNA1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Others
  100344921 (EFNA1)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100344921
NCBI-ProteinID: XP_002715379
Ensembl: ENSOCUG00000004307
UniProt: G1SLI2
LinkDB
Position
13:complement(37536128..37541928)
AA seq 205 aa
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRDADYTVHVRLSDYLDIICPHYEDNSVA
DAAMERYTLYLVEHEDYQLCQPRSKDQVRWQCNQPNAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHHQEDQCLRLKVTVNGKITHSPQAHANPQEKRLPADDPEVQVLHSIG
HSAAPRLFPLAWAVLLLPLLLLQTH
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagttcctctgggccccactcctgggtttgtgctgcagtctggccgctgcggaccgc
cacaccgtcttctggaacagttccaatcccaagttccgggatgcggactacaccgtgcac
gtgcgcctgagtgactacctggacatcatctgtccgcattacgaggacaactccgtggca
gacgccgccatggagcggtacacactgtacctggtggagcatgaggactatcagttgtgc
cagccccgctccaaggaccaagtccgctggcagtgcaatcagcccaacgccaagcacggc
ccagagaagctgtctgagaagttccagcgcttcacacctttcacgctgggcaaggagttc
aaagaaggacacagctactactacatctcgaaacccattcaccaccaagaagaccagtgc
ttgaggctgaaggtgaccgtcaatggcaaaatcactcacagtcctcaggcccacgccaat
ccacaggagaagagactcccagcagatgacccagaggtgcaggttctacatagcatcggt
cacagcgctgccccccgcctcttcccacttgcctgggctgtgctgctcctgccacttctg
ctgctgcaaacccactga

KEGG   Oryctolagus cuniculus (rabbit): 100358004
Entry
100358004         CDS       T03373                                 
Symbol
EFNA5
Name
(RefSeq) ephrin A5
  KO
K05462  ephrin-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100358004 (EFNA5)
   04014 Ras signaling pathway
    100358004 (EFNA5)
   04015 Rap1 signaling pathway
    100358004 (EFNA5)
   04151 PI3K-Akt signaling pathway
    100358004 (EFNA5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100358004 (EFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100358004 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358004 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100358004 (EFNA5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100358004 (EFNA5)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100358004 (EFNA5)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100358004 (EFNA5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Others
  100358004 (EFNA5)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100358004
NCBI-ProteinID: XP_002714002
UniProt: G1TAW8
LinkDB
Position
11:complement(26857280..27169088)
AA seq 228 aa
MLHVEMLTLLFLVLWMCVLCQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLRVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctgctgtttctggtgctctggatgtgtgtgctctgc
caggacccgggctccaaggccgtcgccgaccgctacgcagtctactggaacagcagcaac
cccagattccagaggggtgactaccacattgacgtctgcatcaatgactacctggatgtt
ttctgcccgcactatgaggactctgtcccagaagataagactgagcgctatgtcctctac
atggtgaactttgatggctacagtgcctgcgaccacacttccaaaggattcaagagatgg
gaatgtaaccggcctcactctccaaatggaccgctcaagttctctgaaaaattccagctc
ttcacccccttttctctaggatttgaattcaggccaggccgagaatatttctacatctcc
tctgccatcccagataatggaagaaggtcctgtctaaagctcagagtgtttgtgagacca
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggagagaacgcggcccagacaccaaggatacccagccgccttttggcaatcctgctgttc
ctcctggcgatgcttttgacattatag

KEGG   Oryctolagus cuniculus (rabbit): 100358959
Entry
100358959         CDS       T03373                                 
Symbol
EFNA3
Name
(RefSeq) ephrin A3
  KO
K05462  ephrin-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100358959 (EFNA3)
   04014 Ras signaling pathway
    100358959 (EFNA3)
   04015 Rap1 signaling pathway
    100358959 (EFNA3)
   04151 PI3K-Akt signaling pathway
    100358959 (EFNA3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100358959 (EFNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100358959 (EFNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358959 (EFNA3)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100358959 (EFNA3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100358959 (EFNA3)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100358959 (EFNA3)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100358959 (EFNA3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Others
  100358959 (EFNA3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100358959
NCBI-ProteinID: XP_008262582
Ensembl: ENSOCUG00000007079
LinkDB
Position
13:complement(37580350..37583345)
AA seq 238 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRSGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTLLAS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggcggctccgctgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaggggcccgggggggctctgggcaaccggcatgcggtgtactggaacagctcc
aaccagcacctgcggcgagagggctacaccgtgcaggtgaacgtgaacgattacctggac
atctactgccctcactacaacagctcgggggtgggccccggggcggggccggggcccgga
ggcggggcagagcagtacgtgctgtacatggtgagtcgcagcggctaccgcacctgcaac
gccagccaaggcttcaagcgctgggagtgcaaccgaccgcacgcgccccacagccccatc
aagttctcggagaagttccagcgctacagcgccttctcgctgggctacgaattccacgcc
ggccacgagtattactatatctccacgcccacccacaacctgcactggaagtgtctgagg
atgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggtccccact
ctcccccagttcaccatgggccccaatgtgaagatcaacgtgctggaagactttgaggga
gagaacccccaggtgcccaagcttgagaagagcatcagcgggaccagccccaagcgggaa
cacctgcccttggccgtgggcatcgccttcttcctcatgacactcttggcctcctag

KEGG   Oryctolagus cuniculus (rabbit): 103350046
Entry
103350046         CDS       T03373                                 
Symbol
EFNA4
Name
(RefSeq) ephrin A4
  KO
K05462  ephrin-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103350046 (EFNA4)
   04014 Ras signaling pathway
    103350046 (EFNA4)
   04015 Rap1 signaling pathway
    103350046 (EFNA4)
   04151 PI3K-Akt signaling pathway
    103350046 (EFNA4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103350046 (EFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103350046 (EFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103350046 (EFNA4)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    103350046 (EFNA4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    103350046 (EFNA4)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   103350046 (EFNA4)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   103350046 (EFNA4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Others
  103350046 (EFNA4)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 103350046
NCBI-ProteinID: XP_008262583
UniProt: A0A5F9CWP6
LinkDB
Position
13:complement(37599542..37603401)
AA seq 204 aa
MRPLPLLWTVLWAALLGSPLRGGSSLRHPIYWNSSNPRLLRGDAVVELGLNDYLDIYCPH
YEGPGPPEGPETFALYMVDWRGYQACRAEGAGAFKRWVCSLPFAPSGPVRFSEKIQRFTP
FSLGFEFLPGETYYYISVPTPEAPGRCLRLQVSVCCKESKSESAHPVGSPGESGTSGWRG
GHAPSPLCLLLLLLLPILRLLRVL
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcggccgctgcccctgctgtggactgtcctgtgggccgcgctcctcggctcccctctg
cggggaggctccagcctccgccaccccatctactggaactccagcaaccccaggctgctc
cgaggtgacgccgtggtggagctgggtctcaacgactacctggacatctactgcccgcac
tatgaaggcccagggccccccgagggccccgagacctttgctctgtacatggtggactgg
cggggctaccaggcctgccgggccgagggcgcgggcgcctttaagcgctgggtgtgctcg
ctgcccttcgccccctctggccctgtgcgcttctcagaaaagattcagcgcttcaccccc
ttctccctgggttttgagttcttgcctggagagacctactactacatctcggtgcccact
ccggaggctcctggcaggtgcctgaggctgcaggtgtccgtctgctgcaaggagagcaaa
tctgagtccgcccatcccgtcggaagccccggagagagcggcacatcggggtggcgaggg
ggccacgcgcccagccccctctgtctcttactgctgctgctgctcccaatcctacgtctg
ctgcgagtcctctga

DBGET integrated database retrieval system