KEGG   Oryctolagus cuniculus (rabbit): 100345046
Entry
100345046         CDS       T03373                                 
Symbol
PTCH1
Name
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04024  cAMP signaling pathway
ocu04340  Hedgehog signaling pathway
ocu04360  Axon guidance
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100345046 (PTCH1)
   04024 cAMP signaling pathway
    100345046 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100345046 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345046 (PTCH1)
   05205 Proteoglycans in cancer
    100345046 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100345046 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 100345046
NCBI-ProteinID: XP_017197692
Ensembl: ENSOCUG00000002973
LinkDB
Position
1:complement(74447757..74484677)
AA seq 1302 aa
MFNPQLMIQTPKEEGADVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELIT
ETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKI
NYQVDSWEEMLNKADVGRGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLS
RKYMHWQEELIVGGTVRNSSGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDK
AAAILEAWQRTYVEVVHQSVSANSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLA
YACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVG
VDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALR
AFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYT
EAHDSTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVT
VTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKV
VVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYVVTQKAD
YPNIQHLLYDLHKSFSNVKYIMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGRIMPN
NYKNGSDDGVLAYKLLVQTGSREKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDP
VAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAI
EKVRAICNNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLSISVVLACTFLVCAVFLLNPW
TAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDK
NRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLL
PVLLSFFGPYPEVSPANGLHRLPTPSPEPPPGVVRFAVPPSHTNNSDSSDSEYSSQTTVS
GLSEELRHYEAERGAGGPAHQVIVEATENPVFARSTVVHPEARHHHHPPFNPRQQPHLDS
GPLSPGRQSQQPRRDAPREGLRPPPYRPRRDAFEVSTEGHAGPSHRDRSGPRGARPHHPG
NTASAAGAGSVPGYRQPITTVTASASVTVAVHPPPVPGPGPGRNPRGGLCPGYEGYPETD
HGLFEDPHVPFHVHCERRDSKVEVIELQDVECEEQPRGGSSN
NT seq 3909 nt   +upstreamnt  +downstreamnt
atgttcaatcctcaactcatgatccagaccccgaaagaagaaggtgctgatgtcctgacc
acagaagcactccttcaacacctggactcggcgctccaggccagccgagtccacgtctac
atgtacaacaggcagtggaaattggaacatttgtgttacaaatcaggagaactgatcaca
gagacaggttacatggatcagataatagaatacctttacccgtgtttaattattacacct
ctggattgcttctgggaaggtgctaagctccagtccgggacggcttacctcctggggaaa
cctcctttgcggtggacaaattttgaccctttggaattcctggaagagttaaagaagatc
aactatcaagtggacagctgggaggagatgctgaacaaggctgacgtcggccgtgggtat
atggatcgaccctgcctcaatccagcagacccagactgcccggccacagcccccaacaaa
aactcaaccaaaccgctcgatatggcccttgttttgaatggtgggtgtcatggattatcc
cgcaagtatatgcactggcaggaggagttgattgtgggtggtacagtccgaaacagcagt
ggaaagcttgtcagcgcccacgccctgcaaaccatgttccagctaatgacgcccaagcaa
atgtacgagcacttcaagggctacgaatacgtctctcacatcaactggaacgaggacaag
gcggcagccatcctggaggcctggcagaggacatatgtggaggtggtccatcagagcgtt
tccgccaactccacgcagaaggtgctgtcttttaccaccaccacactggacgacatcctc
aagtcgttctccgacgtcagcgtcatccgcgtagccagcggctacctactcatgcttgcc
tacgcctgtttaaccatgctacgctgggactgctccaagtctcagggggccgtggggctg
gctggcgtcctgttggtggccctgtccgtggctgcaggcttgggcctgtgctccttgatt
gggatctcctttaatgctgcaacaactcaggtcttgccattcctcgccctcggagtcggc
gtggacgacgtcttccttctggcccacgcgttcagtgagacggggcagaacaaaagaatc
ccgtttgaggaccggaccggggagtgcctcaagcgcacgggcgccagcgtggcgctcaca
tccatcagcaacgtcaccgccttcttcatggccgcgctaatcccaattcccgctctgcga
gccttctcgctccaggctgcagtggtggtggtcttcaatttcgccatggtcctgctcatc
ttccctgcaatcctcagcatggatctgtatcgccgggaagacaggagactggacattttc
tgctgtttcacaagcccctgcgtcagcagagtgattcaggtggagccgcaggcctacacc
gaggcccacgacagcacgcgctacagccccccgccaccctatagcagccacagcttcgcc
cacgaaacgcagatcaccatgcagtccaccgtccagctccgcaccgagtacgacccccac
acgcacgtgtactacaccacggccgagccgcgctccgagatttctgtgcagcctgtcact
gtgacccaggacaccctgagctgccagagcccggagagcactagctccacgagggacctg
ctctcccagttctccgactccagcctccactgcctcgagcccccctgcaccaagtggacg
ctctcgtctttcgcggagaagcactacgcgcccttcctcctgaagcccaaagccaaggtc
gtggtgatcttccttttcctgggcctgctgggggtcagcctgtacgggaccacccgagtg
agggacgggctggacctcacagacatcgtccctcgggagaccagagagtacgacttcatc
gccgcgcagttcaaatacttctctttctacaacatgtacgtggtcacgcagaaggccgac
tacccgaacatccagcacttgctgtacgacctgcacaagagcttcagtaacgtgaagtac
atcatgttggaggagaacaagcagcttcccaaaatgtggctgcattacttcagggactgg
ctgcaggggctccaggatgcgttcgacagtgactgggaaacaggcagaatcatgccgaac
aattacaaaaacggatcggacgacggggttctggcctacaagctcctggtgcagactggc
agccgcgagaagcccatcgacatcagtcagttgacgaaacagcggctggtggacgccgat
ggcatcatcaaccccagcgctttctacatctacctgacggcctgggtcagcaacgacccc
gtggcgtacgccgcctcccaggccaacatccggccgcaccggcccgagtgggtgcacgac
aaagccgactacatgccagaaaccaggctgagaatccctgccgcggaaccgatcgagtac
gcccagttccctttctacctcaacggcttgcgagacacctccgactttgtggaagcgatc
gagaaagtgcgagccatttgcaacaactacacgagcctgggcctgtccagctaccccaac
ggctaccccttcctcttctgggagcagtacatcgggctgcgccactggctgctgctgtcc
atcagcgtggtgttggcctgcacgttcctcgtgtgcgccgtcttcctcctgaacccctgg
acagccgggatcattgtgatggtcctggccttgatgacagtcgagctctttggcatgatg
ggactcatcggcatcaagctgagcgccgtgcccgtggtcatcctgatcgcgtctgtcggc
ataggagtggaattcaccgttcacgttgctttggccttcctgaccgccatcggggacaag
aaccgccgggctgtgcttgccctggagcacatgttcgcgccggtcctggacggcgccgtg
tccactctgctgggggtgctgatgctggcggggtcggagtttgatttcattgtcaggtat
ttctttgctgttctggccatcctgacgatcctgggcgttctcaacggactggtcttgctg
ccagtcctcttgtctttctttggaccatatcctgaggtgtctcccgccaacggtcttcac
cgactgcccaccccttcccctgagccaccccctggcgtggtccggtttgccgtgcccccc
agccacaccaacaactccgactcctctgactcggaatacagctcccagacgaccgtgtcg
ggtctcagcgaggagcttcggcactacgaggctgagcggggcgctgggggccccgcccac
caggtgatcgtggaagccacggaaaacccagtcttcgcccgctccacggtggtccatccc
gaagcgcgacatcaccatcacccgccattcaaccctcgacagcagccccacctggactca
gggcccctgtcccccggccggcagagccagcaaccccgcagggatgcccccagagagggc
ttgcggccgcccccctacagaccgcgcagagacgcttttgaagtttctactgaagggcac
gctggccccagccacagggaccgctcgggcccccgcggggcgcgccctcaccaccccggg
aacacggcgagtgctgcgggggccggcagcgtgccgggctaccgccagcccatcaccact
gtgacggcgtctgcttccgtgactgtggccgtgcaccccccacccgtgccggggcccgga
ccggggcggaacccccgagggggcctctgccctggctacgagggctacccagagactgac
cacgggctgttcgaggatccccacgtgcctttccacgtccactgtgagaggagggactcc
aaggtggaggtcatagagctacaggacgtggagtgtgaggagcagccccggggaggcagc
tccaactga

DBGET integrated database retrieval system