KEGG   Oryctolagus cuniculus (rabbit): 100345211
Entry
100345211         CDS       T03373                                 
Symbol
CHMP5
Name
(RefSeq) charged multivesicular body protein 5
  KO
K12198  charged multivesicular body protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345211 (CHMP5)
  09143 Cell growth and death
   04217 Necroptosis
    100345211 (CHMP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345211 (CHMP5)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100345211 (CHMP5)
SSDB
Motif
Pfam: Snf7 NPV_P10 Prefoldin_2 Alpha-E DUF6674 dCache_2 TBCC_N DUF848
Other DBs
NCBI-GeneID: 100345211
NCBI-ProteinID: XP_002708076
Ensembl: ENSOCUG00000008948
UniProt: G1SW78
LinkDB
Position
1:complement(20166698..20183808)
AA seq 219 aa
MNRFFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDASEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDS
SYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaaccgattcttcgggaaagcgaaacccaaggctccgccgcccagcctgactgactgc
attggcacggtggacagcagggcagaatccatcgacaagaagatttcccgattggatgct
gagctagtgaaatacaaggatcagatcaagaagatgagagagggtcctgcaaagaacatg
gtcaagcagaaagccttgcgggtgttaaagcaaaaacggatgtatgagcagcagcgggac
aaccttgcccagcagtcattcaacatggaacaagccaattacaccatccagtcactgaaa
gacaccaagaccacggttgatgctatgaaactgggagtaaaggaaatgaagaaggcatac
aagcaagtgaaaatcgaccagattgaggatttacaagaccagctagaggatatgatggaa
gatgctagtgaaatccaagaagcactgagtcgtagttatggcaccccggagttagatgaa
gatgaccttgaagctgagctcgacgccctgggtgatgagctcctggctgatgaagatagt
tcttacttggatgaagcagcatctgcgcctgcaattccagaaggtgttcccactgacaca
aaaaacaaggatggagtgctggtggatgaatttggattgccacagatccctgcttcatag

DBGET integrated database retrieval system