KEGG   Oryctolagus cuniculus (rabbit): 100345279
Entry
100345279         CDS       T03373                                 
Symbol
NRP1
Name
(RefSeq) neuropilin 1
  KO
K06724  neuropilin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu05166  Human T-cell leukemia virus 1 infection
ocu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100345279 (NRP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345279 (NRP1)
   05171 Coronavirus disease - COVID-19
    100345279 (NRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100345279 (NRP1)
CD molecules [BR:ocu04090]
 Proteins
  100345279 (NRP1)
SSDB
Motif
Pfam: CUB F5_F8_type_C DUF3481 MAM Ecm33
Other DBs
NCBI-GeneID: 100345279
NCBI-ProteinID: XP_008272962
Ensembl: ENSOCUG00000004579
LinkDB
Position
Un
AA seq 922 aa
MERAPLLCAALALALAAAGAFRSDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLLQAP
DPYQRILINFNPPFDLEDRDCKYDYVEVIDGESEHGRPAGKFCGKIAPPPVVSSGPFLFV
RFVSDYETHGAGFSIRYEIYKRGPECSQNYTSPSGVIKSPGFPEKYPNSLECTYIIFAPK
MSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRASSG
ILSMVFYTDSAIAKEGFSANYSVLQGSVAEDFKCMEALGMESGEIHSDQITASSQYSTNW
SAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKRYFVKTYRVD
VSSNGEDWITLKEANKALIFQGNSNPTDVVFGIFPKPLITRFVRIKPLTWETGISMRFEV
YGCKITDYPCSGMLGLVSGLISDSQITASNQGDRNWMPENVRLVTSRSGWALPPAPHPYT
NEWLQVDLGEEKVVRGVIVQGGKHRENKVFMKKFKIGHSHNGSDWRMITDDSKRKAKSFE
GNSNYDTPELRTFPPVSTRFIRIYPERATHGGLGLRMELLGCELEVPTAGPTTPNGNPMD
ECDDDQATCHSGTGDDLQLTGGTTVLTTEKPTVIDSTMQSEFPTYGFNCEFGWGSHKTFC
RWEHDSHVQLRWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVSSQSSAHC
MTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIF
EGEIGKGNLGGIAVDDISINNHISPEDCAKPADLDRKNPEIKIDETGSTPGYEGEGEGDR
NISRKPGSVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSDRNLSALENYNF
ELVDGVKLKKDKLNTQSSYSEA
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggagagggcgccgctcctctgcgccgcgctcgcgctggccctggccgcggccggcgcc
ttccgaagcgataaatgcggggacaccatcaaaatcgagagccccgggtacctgacgtcc
cccggctacccgcactcctaccacccgagcgagaagtgcgagtggctgctgcaggcgccc
gacccctaccagcggatcctcatcaacttcaacccccccttcgacctggaagaccgcgac
tgcaagtacgactacgtggaggtcatcgacggggagagcgagcacgggcgtccagcgggc
aagttctgcgggaagatcgccccaccgcccgtcgtgtcctcggggcccttcctcttcgtc
aggtttgtctcagactacgagacgcacggcgcagggttctccatccgctacgagatttac
aagagaggtcctgagtgctcccagaactacacgagccccagcggcgtgattaagtccccc
gggttccccgagaaataccccaacagcctggagtgcacttacatcatcttcgctccgaag
atgtcggagatcatcctggagtttgaaagcttcgacctggaaccggactccaaccccccc
ggggggatgttctgccgctacgaccggctggagatctgggacggcttccccgacgtgggc
cctcacatcggacgctactgtgggcagaaaacgccgggccgcatccgagcctcctcgggc
atcctgtccatggtgttctacaccgacagcgccattgccaaggagggcttctcggccaac
tacagcgtcctgcagggcagcgtcgcggaagatttcaagtgcatggaagctctgggcatg
gagtcaggggagatccattccgaccagatcacggcctcctcccagtacagcaccaactgg
tctgcagagcgctcccggctgaactaccccgagaacgggtggacacccggggaggactcc
taccgagagtggatacaggtggacctgggcctcctgcgctttgtcacagctgtggggaca
cagggcgccatttccaaggagaccaagaagaggtacttcgtgaagacctacagggtagac
gtcagctccaatggggaggactggatcaccctgaaggaagcgaataaagccctgatcttc
caggggaactccaaccccaccgatgtggtgttcggcattttccccaaaccactgataacg
cggtttgttcgcatcaagcccctgacctgggaaaccggcatctccatgcggtttgaggtc
tacggctgcaagataacagattacccctgctccgggatgctgggcctcgtgtccgggctc
atttccgactcccagatcacagcatccaaccagggggaccggaactggatgcctgagaac
gtgcgcctggtgaccagccgctctggctgggccctgccaccagccccccacccctacacc
aacgagtggctccaggtggacctgggtgaggagaaggtggtgaggggtgtcatcgtgcag
ggcggcaagcaccgggagaacaaggtgttcatgaagaagttcaagatcgggcacagccac
aacggctccgactggaggatgatcacagatgacagcaaacgcaaggccaagtctttcgag
ggcaacagcaactatgacacacccgagctgcggaccttcccaccagtgtccacgcggttc
atccggatctaccctgagagggccacccacggcggcttggggctgcgcatggagctgctg
ggctgcgagctggaagtgcccacagcggggccaaccacccctaacgggaaccccatggat
gagtgtgacgacgaccaggccacctgccatagcggcacgggggatgacctccagctcaca
ggtggcaccactgtactgaccacggagaagccgacggtgatagacagcaccatgcaatca
gagttccccacatacggattcaactgcgagttcggctggggctcacacaagaccttctgt
cgctgggagcatgacagccacgtgcagctccggtggagtgtgctgaccagcaagactggg
cccatccaggaccacacaggagacggcaacttcatctactcccaggctgatgagaaccag
aagggcaaggtggcccggctggtgagccccgtggtgtcctcgcagagcagcgcccactgc
atgaccttctggtaccacatgtccggctcccacgtgggcacactgagggtcaagctgcgc
taccagaagcctgaggagtacgatcagctggtctggatggccatcgggcaccaaggagac
cactggaaggagggccgtgtgctgctgcacaagtccctgaagctttaccaggtgattttt
gagggtgaaattggcaaaggaaacctgggtgggattgcggtggatgacatcagtatcaac
aaccacatctccccagaggactgtgcaaaaccagcagacctggacagaaagaacccagaa
attaaaatcgatgaaacaggcagcaccccaggttacgaaggcgaaggggaaggagacagg
aacatctcccggaagccaggcagcgtgctgaagaccctggaccccatcctcatcaccatc
atcgccatgagcgctctgggggtgctgctgggcgccgtgtgtggggtggtgctgtactgt
gcctgctggcacaacggcatgtcggacaggaacttgtctgccctggagaactacaacttt
gagctcgtcgacggcgtgaagttgaaaaaggacaagctgaacacgcagagcagttactca
gaggcgtga

DBGET integrated database retrieval system