KEGG   Oryctolagus cuniculus (rabbit): 100345580
Entry
100345580         CDS       T03373                                 
Symbol
EEA1
Name
(RefSeq) early endosome antigen 1
  KO
K12478  early endosome antigen 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345580 (EEA1)
   04145 Phagosome
    100345580 (EEA1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100345580 (EEA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345580 (EEA1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100345580 (EEA1)
 Protein recycling
   Other Rab GTPase associated proteins
    100345580 (EEA1)
SSDB
Motif
Pfam: FYVE ATG14 Crescentin IBR
Other DBs
NCBI-GeneID: 100345580
NCBI-ProteinID: XP_017197503
Ensembl: ENSOCUG00000009295
LinkDB
Position
4:complement(72030518..72212798)
AA seq 1409 aa
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EVVHDAGNDSSHGGEASLALKRDDITLLRQEVQDLQTSLKEEKWYSEELKKELEKYQGLQ
QQEAKPDGLGADSSAEIQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EEKSLREAAEQKVTHLTEELNKEATLIQDLKTELRPGIEDVAVLKKDIVQVQTLMDNMTL
ERERESEKLKDECKKLQAECANSETTISQLRSELAKGPQEVAVYVQELQKLKSSVNELTQ
KNQNLTEKLLKKELDYVQLEEKHNEESVSKKNIQATLHQKDLDCQQLQARLSASETSLQR
SQAELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSK
LLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQ
LDKTKQQHQEQQALQQNTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLL
EKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQV
QEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQR
ADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKHLSLE
QKTEELEGQIKKLEADTLEVKATKEQTFQDLQQQRQLNTDLELRATELSKQLEMEKEITS
STKLDLQKKSEALDNIKQMLAKQEEEKIILKQEIENISQDAKMQHKELNSRMQTAVTELQ
TVKAEKETLVTELSTTKEKLSQVSDYLKQCKDEFEKENQKGKAAILDLEKTCKELKHQLQ
IQTASTHKEQNELKKSLEKEKETSHQLKLELNSMQEQVLQAQNTLKQKEKEEQQLQGNIN
ELKQSAEQKKKKIEALQGEIKIAILQKTELESKLQQQSTQAAQELAAEKEKISVLQNTYE
KSQENLKQLQSDFYGKESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKT
AKVTLEQDSAKKEQQLKEQSKALQDIQKEKSLKEKELVNEKSRLAEIEEVKTRQEKEITK
LTEELKSHKQESIKEVTNLKDAKQLLIQQKLELQGKVDSLKATLEQEKKNQQMLKEQMKK
EEDELKKEFIEKEAKLNSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQR
RVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDN
TTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFC
AECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4230 nt   +upstreamnt  +downstreamnt
atgttaaggaggattttgcagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcaactcccataaacacggtggatgtcaataatgaaagctcttcagagggc
ttcatatgtccccagtgtatgaagtctcttggctctgctgatgaacttttcaaacactat
gaggtggttcatgatgctggtaatgattcaagtcatggaggagaggccagtcttgctttg
aagcgcgatgatataacactactcagacaagaagtacaagacctacagacttcacttaag
gaagaaaaatggtactcagaagaattaaagaaagaattagaaaaatatcaagggctacaa
cagcaagaggccaaacctgatggattgggtgcagactcatcagcagaaatacagtctttg
gaacagcaattagaagaagcccaaacagaaaattttaatattaaacaaatgaaagactta
tttgagcagaaagcagcgcaacttgctactgaaattgcagatattaaatcaaaatatgat
gaagaaaagagtcttcgagaagctgctgaacaaaaagtgacacatctgacagaagaatta
aacaaagaggcaactctaattcaagatctgaagactgaactgagacctggtatagaagat
gttgctgtgctgaagaaagacatagtccaagttcaaacactaatggataatatgaccttg
gaacgtgagagagaatctgaaaaactcaaagatgaatgcaagaagttacaagcagaatgt
gctaactcagagaccacgataagtcagctaaggagtgaacttgccaaaggcccacaggaa
gttgctgtatatgttcaggaactacaaaagcttaagagttcagttaatgaattaacacaa
aaaaatcagaacttgacagaaaagttgctgaaaaaagaactagactatgtccagttagaa
gagaaacataatgaagaatctgtgagcaaaaagaatatacaagcaacccttcatcaaaaa
gacctagattgtcaacagcttcaggcaagattatctgcgtctgaaacttcactgcagaga
tcacaagctgaactaagtgaaaaaggagaagcaactcaaaagctcaaagaggagttatcc
gaagtagagactaagtaccagcatcttaaagcagagtttaaacagctacaacaacagaga
gaagaaaaggaacaacatgggttacaactccaaagtgaaattaaccaattacatagcaaa
cttctcgagacagagcgccaactaggggaagctcatggtaggctgaaggagcagagacaa
ctttcaagtgaaaagctgatggataaagaacagcaagtggctgatttacaactcaaactt
tctcgtttagaagaacagttgaaggaaaaagtaacgaattccacggagttgcagcatcaa
ttagataaaacaaagcaacagcatcaggaacagcaggctcttcagcaaaacactacagca
aaacttcgagaagctcagaatgatttggagcaagtactacgtcaaattggtgataaagat
caaaagatccagaaccttgaagccttattacagaagagtaaagaaaatatttcattacta
gaaaaagaaagagaagatctttatgcaaaaattcaggctggtgaaggagagactgctgtt
cttaaccagttacaagaaaaaaaccacacattacaggagcaagtcactcaattaacagag
aagctgaagaatcagtcagaaagtcataaacaagcccaggaaaatttgcatgaccaggta
caagagcaaaaggcacatcttagagctgcacaagaccgtgtcctttccttggaaaccagt
gtcaatgaattaaatagtcaattaaatgaaagcaaagagaaggtctcccaacttgacata
cagattaaagccaaaactgaattattgctatcagcagaagctgcaaaaactgctcagaga
gctgatcttcagaatcatttggacacagcacaaaatgcattacaagataaacagcaggag
ttaaataagatcaccactcagttggatcaggtcactgcaaagttacaagacaaacaggaa
cattgcagtcagctggaaagtcatctgaaagaatataaagagaaacacctctctttagag
cagaaaactgaagaactagaaggtcaaattaagaaactagaagctgatactcttgaagtt
aaagcaaccaaggaacaaacttttcaggatctacaacaacagaggcaactgaacacagat
ttagagcttagagcaacagaattaagtaaacaacttgaaatggagaaagaaataacctcc
agtacaaaattggatctacagaaaaaatctgaagcccttgacaatattaagcaaatgctt
gctaagcaagaggaagaaaaaataatcctgaaacaagaaattgaaaatataagtcaagat
gcaaagatgcaacacaaggaactgaacagcagaatgcaaacagcagtaacagaattacaa
acagtgaaggcagagaaagaaacgctagtgacagagctgtctacaacaaaagagaaatta
tcacaagtttctgattatttgaaacagtgcaaagatgaatttgaaaaggagaatcagaaa
ggaaaagcggctattttagatttggaaaaaacttgcaaagaattaaagcatcaacttcaa
atacaaacagccagcacacataaggaacagaatgaactgaaaaagtcacttgaaaaagag
aaggagacttctcatcagttgaagttagaattgaattcaatgcaggaacaagtcttacaa
gcccagaatactttaaaacaaaaagaaaaagaagaacaacaacttcaggggaacataaat
gagctcaagcaatcagctgaacagaagaagaagaaaattgaagcactccaaggagaaatt
aaaattgctattttacagaagacagaacttgaaagtaaactacagcagcagtcaactcag
gcagctcaggaactggcagcagagaaagagaaaatatcagtgttacagaacacgtatgaa
aaaagtcaggaaaatctgaaacagcttcagtctgatttctatggaaaggaatctgaactt
ctggccacaagacaagaccttaagtctgtagaagagaaactttctctagcacaggaggac
ttgatttcaaatagaaatcaaattggaaaccaaaataaactgattcaagaactaaagact
gccaaggttactttggagcaggattcagcaaagaaagaacagcaactgaaggaacagagt
aaagcgctacaagatattcaaaaagaaaagtcactgaaagaaaaagaactagtgaatgaa
aaatctagattggcagagattgaagaagttaagactagacaagaaaaagaaatcactaaa
ttaacagaagaactcaagtcccacaaacaagaaagcataaaggaggtaacaaatctcaag
gatgccaagcagcttttgattcagcagaaattagaacttcaaggaaaagtagattctctg
aaggcaactctggaacaggagaagaaaaaccaacagatgctaaaagagcagatgaaaaag
gaggaagatgagctgaagaaagagtttattgagaaagaagctaagttgaattctgaaata
aaagaaaaagaagtaggaatgaagaaacatgaagaaaatgaggctaaacttaccatgcag
attacagctttaaatgaaaacttgggcactgtgaagaaggaatggcaatctagtcaacgg
agagtgagtgagctggagaaacaaacagatgacttacggggtgaaatcgcagtattagaa
gccacagttcagaataatcaagatgaaaggagagcactgttggaaaggtgtcttaaagga
gaaggagaaatagaaaagcttcaaaccaaagtactagaattgcaaagaaagctggacaat
acaactgcagcagtgcaggaactaggcagagaaaaccagtcccttcagatcaaacatacg
caagcattgaatagaaagtgggctgaagacaacgaagttcaaaactgtatggcctgtggg
aaaggcttttcagttacagtgagacggcatcattgccgacagtgtgggaatatcttctgt
gctgagtgttcagccaaaaatgccttaactccttcttccaagaagcctgttcgtgtctgt
gatgcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system