KEGG   Oryctolagus cuniculus (rabbit): 100345703
Entry
100345703         CDS       T03373                                 
Symbol
SRGAP2
Name
(RefSeq) SLIT-ROBO Rho GTPase activating protein 2
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100345703 (SRGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345703 (SRGAP2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    100345703 (SRGAP2)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100345703 (SRGAP2)
SSDB
Motif
Pfam: RhoGAP FCH SH3_1 SH3_2 SH3_9 FlaC_arch
Other DBs
NCBI-GeneID: 100345703
NCBI-ProteinID: XP_017203318
Ensembl: ENSOCUG00000012175
UniProt: A0A5F9CN90
LinkDB
Position
16:complement(65850776..66126295)
AA seq 986 aa
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQ
PVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGE
SQRTDCSLARRSSTVRKQDSGQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKN
AFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALH
IRKVLLVLPQTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSC
QAHVNELIKTIIIQHENIFPNPRELEGPVYSRGGSMEDYCDSPHGETTSAEDSTQDVTTE
HHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQ
YIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINNTLRL
ENPEPTTTEQRKRPESGSIRKTFRSDSHGLSGSLTDSSSPGVGASCRPSSQPILSQSLPK
EGPDKCSISGHGSLNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQRFN
PTCKNPTTGATPSSSLRRLSQLYNFR
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgacgtctccagccaaattcaaaaaggataaggagatcatagcggagtacgatactcag
gtcaaagagatccgtgctcagctcacagagcagatgaaatgcctggaccaacagtgtgag
ctccgggtgcagctgctgcaggacctccaggacttcttccggaagaaggccgagattgag
atggactactcccggaacctggagaagctggctgagcgctttctggctaagacccgcagc
accaaggaccagcagttcaagaaggatcagaatgttctctctccggtcaactgctggaac
ctcctcttaaaccaagtgaagcgagagagcagggaccacaccaccctgagtgacatctac
ctgaataatatcatccctcggtttgtccaagtcagtgaggactcaggaagactctttaaa
aagagtaaagaagttggccagcaactccaggatgatttgatgaaggtcctgaacgagctc
tactcggtcatgaagacgtatcacatgtacaatgccgacagcatcagtgctcagagcaaa
ctgaaggaggcggagaagcaggaggagaagcaaattggtaaatcagtgaagcaggaagac
cggcagaccccacgctcccctgactccactgccaatgtccgcatcgaggagaagcatgtc
cggaggagctccgtgaagaagattgagaagatgaaggagaagcgccaagccaagtacaca
gagaataagctgaaggccattaaagcccggaatgagtacttactggctttggaagccacc
aatgcatctgtcttcaagtactacatccacgacctgtccgaccttattgatcagtgttgt
gacctaggctaccatgctagcctgaaccgggctctgcgcaccttcctttctgctgagtta
aatctggagcagtcgaagcacgagggtctggacgccatcgagaatgcagtagaaaacctg
gatgccacaagtgacaagcagcgcctcatggagatgtacaacaatgtcttctgtccccct
atgaagtttgagttccagccccacatgggggacatggcctcccagctctgtgcccagcag
cctgtccagagcgagctggtgcagaggtgccagcaactgcagtctcgattatccactctg
aagattgagaacgaagaggttaaaaagacaatggaggccaccttgcaaaccatccaggac
attgtgaccgttgaggactttgatgtgtccgactgcttccaatacagcaactccatggag
tctgtcaagtccacagtttcagaaactttcatgagcaaacccagcattgctaagaggaga
gccaaccagcaagagacagagcagttttatttcacgaaaatgaaggagtacctggagggc
aggaacctcatcacgaagctgcaagccaagcacgacctcctgcagaaaaccctgggagaa
agtcagcggacagactgcagtctggccaggcgtagctcaaccgtgaggaagcaggactcg
ggccaggcaattcctctggtggtagaaagctgtatccggtttatcagcaggcacggatta
cagcatgaaggaattttccgggtgtcgggatcccaggtggaagtgaatgacatcaaaaat
gcttttgagagaggagaggaccccctggctggcgaccagaatgaccatgacatggactct
atcgcaggtgtcctgaagctttacttccgggggctggaacaccctctcttccctaaggac
atcttccacgacctgatggcctgcgtcactatggacaacctacaggagagagctctgcac
atccggaaagtcctcctggtcctgccccagaccactctgattatcatgagatacctcttt
gccttcctcaatcatttatcacagttcagtgaagagaacatgatggacccctacaacctc
gccatctgcttcgggccctcgctgatgtcagtgccggagggccatgaccaggtgtcctgc
caagcccacgtgaacgagctgatcaaaaccatcatcatccagcatgagaacatcttccca
aaccccagggagctggagggccctgtctacagcagaggaggaagcatggaggattactgt
gacagccctcacggagagacgacctccgctgaagactcgacccaggacgtgaccacagag
catcacaccagcgatgacgagtgtgagcccatcgaggccattgccaagtttgactacgtg
ggccggacagcgcgagaactgtccttcaagaagggagcatccctgctgctttaccagcgg
gcttccgacgactggtgggaaggccggcacaacggcatcgacgggctcatcccacaccag
tacatcgtggtccaagacaccgaggacggtgtcgtggagaggtccagccccaagtctgag
attgaggtcatttctgagccacctgaagaaaaggtgacagccagagcgggggccagctgt
cccagtgggggtcatgtagccgatatttaccttgcaaacatcaacaacaccttacgtctt
gagaacccagagcccacgaccaccgagcaaaggaagcggccggaatctgggagcatccgg
aaaacattccgtagcgacagccacgggctgagcggttccctgactgactcctcctccccg
ggggtgggggctagctgccgcccgtcctcccagcccatcctcagccagagtctccccaag
gaagggccagataagtgttccatcagcgggcacgggagcctcaactccatcagccgccac
tcatccctgaagaatcggctggacagcccacagatccgcaagaccgccacggcagggagg
tcgaagagcttcaacaaccatcggcccatggaccctgaggtcattgcacagcgattcaac
cccacctgtaaaaatccgaccaccggggccactccaagcagttccctcagacgtctctcc
caactatataatttccgttag

KEGG   Oryctolagus cuniculus (rabbit): 100357985
Entry
100357985         CDS       T03373                                 
Symbol
SRGAP1
Name
(RefSeq) SLIT-ROBO Rho GTPase activating protein 1
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100357985 (SRGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100357985 (SRGAP1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    100357985 (SRGAP1)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100357985 (SRGAP1)
SSDB
Motif
Pfam: RhoGAP FCH SH3_1 SH3_9 SH3_2 FTZ FlaC_arch
Other DBs
NCBI-GeneID: 100357985
NCBI-ProteinID: XP_002711354
Ensembl: ENSOCUG00000009694
UniProt: G1SXQ8
LinkDB
Position
4:42696127..43011794
AA seq 1085 aa
MSTPSRFKKDKEIIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIE
TEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQ
QLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTRP
PSVPPKPQKHRKSRPRSQYNAKLFNGDLEAFVKDSGQVIPLIVESCIRFINLYGLQHQGI
FRVSGSQVEVNDIKNSFERGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDL
ISCIRIDNLYERALHIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMPVPEIQDQVSCQAHVNEIVKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYS
EHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYVGRSARELTFKKGASLLLYHRASEDW
WEGRHNGVDGLVPHQYIVVQDMDDAFSDTLSQKADSEASSGPVTEDKSSSKDMSSPTDRH
SDGYLARQRKRGEPPPPGRRPGRTSDGHCPLHPPHALSNSSVDLGSPSLASHPRGLLQNR
GLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYTSFNDHKPLDPETIAQ
DIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHSAALRSA
EPQIRRSTSSSSDTMSTFKPVVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPSQGPTD
KSCTM
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgtccaccccgagcagattcaagaaggacaaagagatcatagccgagtatgaaagtcaa
gtcaaagaaattcgcgcccaactggtggagcaacagaaatgcctggagcagcagacagag
atgcgagttcagcttctccaggacctgcaggatttcttccggaaaaaagctgaaattgag
accgaatactcccggaacctggagaaattagcagaaaggttcatggcaaaaacgagaagc
accaaggatcaccaacaatacaagaaagaccagaacctgttgtctccagtgaactgctgg
tacctgctgctgaaccaagtgaggagagaaagcaaggaccacgccaccctgagtgacatc
tacctgaacaatgtgatcatgcggttcatgcagatcagcgaggattccacccggatgttt
aagaagagcaaagagattgcattccaacttcatgaggatttaatgaaggttcttaatgag
ctttatacggtgatgaaaacgtaccacatgtatcacgcagagagcatcagtgcagagagc
aagctgaaagaggcagagaaacaggaggagaagcaaattgggagatcgggtgatccagtc
ttccatattcgactggaagagcgacatcagcgacgaagctctgtaaagaaaattgaaaaa
atgaaagaaaagagacaagcaaagtattcagaaaataagctgaaatcgattaaggcacgg
aatgaatatctcctaacacttgaagccaccaatgcctcagttttcaagtattatattcat
gatctttcagatttgattgattgctgtgatcttggctaccacgcaagtctgaacagagcc
ctgagaacatacctctctgcggagtataacctcgaaacctcccgacacgaaggcttggac
atcattgagaacgcagttgacaatttagagcccaggagcgataagcagagattcatggag
atgtaccctgctgcattctgtccaccaatgaagtttgagtttcagtctcacatgggtgat
gaggtgtgtcaggtcagcgcgcagcagccagtccaggcagagctcatgctcaggtaccag
cagctgcagtcccgactggccacgctcaaaatcgagaatgaggaggttaagaaaacgact
gaagccaccttgcagacgatacaagacatggtcaccatcgaggactacgatgtttctgaa
tgcttccagcacagtcgctccacagagtcggtgaagtctactgtctctgaaacctacctg
agtaagcccagcatcgccaagagaagagctaaccagcaggaaaccgagcagttctacttc
atgaaactcagagaatatttggaaggcagcaatctcatcacaaagctccaggccaagcat
gacttgctgcagaggacccttggagaaggtcacagagctgaatatatgaccacaaggcct
cccagtgttccccctaagccccagaaacacaggaagtccagaccccgctcacagtataat
gctaagttgtttaatggggatttggaagcattcgtcaaggactcgggacaggtgatcccc
ctcattgtggagagctgcattcggttcatcaacctctatggtcttcagcatcaggggatt
ttcagagtgtctggttcccaggtggaagtcaatgatatcaaaaactcatttgagagaggt
gaaaatcctttggctgatgaccagagtaaccatgatattaattctgtggctggtgttctg
aagctctacttccgtgggctggaaaaccccctctttcctaaggaaagatttaatgatctg
atttcttgtatcagaatagataatctctatgagagggcgcttcacatccgcaaactcctc
ctgaccctgcccaggtccgtcctgatagtgatgaggtacctctttgctttcctcaatcat
ctttcacagtacagtgatgagaacatgatggatccttacaacctggccatttgctttggc
ccaacactgatgcctgtcccagaaatacaggatcaggtgtcttgccaggctcacgtgaat
gaaattgtcaaaaccatcatcatccaccatgagaccattttcccagatgctaaagaactg
gatggcccagtttatgagaaatgtatggctggagatgactactgtgacagcccatacagt
gagcacggtacgttggaggaagtggaccaggatgctggtacagagccccacaccagcgaa
gatgagtgtgagccaatagaagcaatagccaagtttgactacgttggacgatctgccaga
gagctgaccttcaagaaaggcgcctcactgctgctgtaccaccgcgcctccgaggactgg
tgggaaggccgacacaacggggtcgacgggcttgtgccccaccagtacatagtggtgcag
gatatggatgatgcattttcagacactctgagccaaaaagccgacagtgaagccagcagt
gggccagtcaccgaggacaagtcttcgtccaaggacatgagctccccgacggaccggcac
tccgacggctacttggccagacaaaggaaaagaggagagccgccccctccaggaaggcgt
cctggcaggaccagtgatggccactgccccctccacccgccacatgctctttccaactcc
tcagttgacctggggtccccaagcctggccagtcacccccggggcctgctgcagaaccgt
ggcctcaacaacgacagtcccgagaggaggcgccgccccggccacggcagcctgaccaac
atcagccggcacgactccctcaagaagatcgacagcccccctatcaggaggtccacgtca
tcagggcagtacacaagcttcaacgaccacaagcccctggacccagagacgattgctcag
gacatcgaagagacgatgaacaccgctttgaatgagctccgagaactggagcgacagagt
acagccaagcacgcgccggatgtggtgctggataccttggaacaagtgaaaaactctccc
acgccagccacctccacggaatctctcagccctttgcacagcgctgccctcaggagcgcg
gagcctcagatccggcgtagcactagctcctccagtgacacgatgagtactttcaagccc
gtggtggcacccagaatgggcgtgcagctgaagcccccagcccttaggccaaaacctgct
gttcttccaaaaacaaatcctaccataggacctgccccaccttcccagggtccgacagac
aagtcttgcacgatgtga

KEGG   Oryctolagus cuniculus (rabbit): 103345512
Entry
103345512         CDS       T03373                                 
Name
(RefSeq) SLIT-ROBO Rho GTPase-activating protein 3
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103345512
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103345512
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    103345512
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    103345512
SSDB
Motif
Pfam: RhoGAP FCH SH3_1 SH3_2 SH3_9 Flg_hook FlaC_arch
Other DBs
NCBI-GeneID: 103345512
NCBI-ProteinID: XP_008248207
LinkDB
Position
Un
AA seq 853 aa
MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
AIESAVDSLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRHH
QLQSRLATLRIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM
SKINIAKRRANQQETEVFYFTKFKEYVNGSNLITKLQAKHALLKQTLGEGERAECGTTRP
PCLPPKPQKTRRPRPLSVYSHKLFNGSMEAFIKESGQAIPLVVESCIRYINLYGLQQQGI
FRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISTIKLETPAERVHQIQQILVTLPRAVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEDYCDSPH
SEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASED
WWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTE
HISDYGFGGVMGR
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgtcatctcaaactaagttcaagaaagacaaagagatcatcgctgaatacgaggctcaa
ataaaagagatccgcacgcagctggtggagcagttcaaatgcctggagcagcagtcggag
tcgcggctgcagctgctgcaggacctccaggagtttttccgcaggaaagccgagatcgag
ctggagtactcccgcagcctggagaagctggccgagcgcttctcctccaagatccgcagc
tcccgggagcaccagttcaagaaggaccagtaccttctgtcgcccgtgaactgctggtac
ctggtcctgcaccagacccggcgggagagccgggaccatgccaccctcaacgacatcttc
atgaacaacgtcatcgtccgcctgtcccagatcagcgaggatgtcatcaggctcttcaaa
aagagcaaggaaattgggctgcagatgcacgaggagctcctgaaggtcaccaacgagctg
tacacggtcatgaagacctaccacatgtaccacgcggagagcatcagtgccgagagcaag
ctgaaggaggctgagaagcaggaggagaagcagttcaacaagtcgggagagctcagcatg
aacctgctgcggcacgaggaccggccccagcgccgcagctctgtgaagaagatcgagaag
atgaaggagaagaggcaggccaagtactccgagaacaagctcaagtgcacgaaggcccgc
aacgactacttgctgaacctggcagccaccaacgcggcgatcagcaaatactacatccat
gacgtctccgacctgatcgattgctgcgatttgggctttcacgccagcctggcccgcacc
ttccggacctacctctcagcggaatacaacctggagacctcgcgccacgaggggctggac
gccatcgagagcgccgtggacagcctggattcccggagtgacaagcacacagtcatggac
atgtgcaaccaggtcttctgcccgccactcaagttcgagttccagccccacatgggggac
gaggtatgccaggtcagcgcccagcagcccgtgcagacggaattgctcatgcggcaccac
cagctgcagtccagactggccacgctcaggatagagaatgaggaggtgaggaagaccctg
gacgccaccatgcagaccctgcaggacatgctgaccgtggaggacttcgacgtgtccgac
gccttccagcacagccgctccacagaatccgtgaagtcggctgcctccgagacctacatg
agtaagatcaacatcgccaagaggagggccaaccagcaggagaccgaggtgttctacttc
acgaaatttaaggagtatgtgaacggcagtaacctcatcaccaagctccaggccaagcac
gccctactcaagcagacgctgggcgagggggagagagcagagtgtggcaccaccaggccc
ccctgcctgccccccaaaccacagaaaacgaggagacctaggcctctctcagtgtatagc
cataagctctttaacggcagtatggaagcgttcattaaggagtcaggacaagccataccg
ctcgtagtggagagctgcatccgatacatcaacttatatggactgcagcagcagggcatc
ttcagagtgcctgggtctcaggtcgaggtcaacgatatcaaaaattcctttgagagaggt
gaagaccccctcgtggacgaccaaaatgagcgagatatcaactcggtcgccggtgtctta
aaactgtatttccgaggactggaaaacccactctttcctaaggaaaggtttcaagacttg
atatctaccattaaactggagaccccagccgagagggtgcatcagatccagcagatcctc
gtcaccctgccccgcgccgtcatcgtggtcatgagatacctcttcgccttcctcaaccac
ctctcccagtacagcgacgagaacatgatggatccctacaacctggccatctgcttcggg
cccaccctcatgcacatcccagatgggcaggaccccgtgtcttgccaggcccacgtcaac
gaagtcatcaaaaccatcatcatccatcacgaagccatcttccccagcccccgggagctg
gagggccccgtgtacgagaagtgcatggctggaggggaggattactgtgacagcccgcac
agcgagccaggcaccatcgacgaagttgaccatgacaacggcaccgagccgcacaccagt
gacgaagaagtggagcagatcgaggccatcgccaagttcgactacgtgggccggtccccg
cgggagctgtccttcaagaagggggcctccctgctgctgtaccaccgcgcgtccgaggac
tggtgggagggccggcacaacggtgtggacggcctcatcccgcaccagtacatcgtggtg
caggacatggacgacgccttctccgacagcctgagccagaaggcggacagcgaggcgagc
agcgggcccctgctggacgacaaggcttcctccaagaacgacctgcagtcccccacagag
cacatctcggactatggctttggaggggtgatgggccggtag

KEGG   Oryctolagus cuniculus (rabbit): 103352092
Entry
103352092         CDS       T03373                                 
Name
(RefSeq) SLIT-ROBO Rho GTPase-activating protein 3
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103352092
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103352092
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    103352092
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    103352092
SSDB
Motif
Pfam: RhoGAP FCH SH3_1 SH3_2 SH3_9 Flg_hook FlaC_arch
Other DBs
NCBI-GeneID: 103352092
NCBI-ProteinID: XP_008271798
LinkDB
Position
Un
AA seq 1099 aa
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQFNKSGELSMNLLRHEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
AIESAVDSLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRHH
QLQSRLATLRIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM
SKINIAKRRANQQETEVFYFTKFKEYVNGSNLITKLQAKHALLKQTLGEGERAECGTTRP
PCLPPKPQKTRRPRPLSVYSHKLFNGSMEAFIKESGQAIPLVVESCIRYINLYGLQQQGI
FRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISTIKLETPAERVHQIQQILVTLPRAVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEDYCDSPH
SEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASED
WWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTE
HISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSLDTPPRAAACPSSPHKIP
LPRGRIESPEKRRMATFGSAGSINFPDKKALSEAHSMRSTCGSTRHSSLGDHKSLEAEAL
AEDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPISSEPASPLHTIVIRD
PDAATRRSSSSSAEMMTTFKPALSARLAGAQLRPPPMRPVRPAVQPRSSSSSSSGVSSPA
VTPTEKMFPNSSADKSGTM
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgacgtctccagccaaattcaaaaaggataaggagatcatagcggagtacgatactcag
gtcaaagagatccgtgctcagctcacagagcagatgaaatgcctggaccaacagtgtgag
ctccgggtgcagctgctgcaggacctccaggagtttttccgcaggaaagccgagatcgag
ctggagtactcccgcagcctggagaagctggccgagcgcttctcctccaagatccgcagc
tcccgggagcaccagttcaagaaggaccagtaccttctgtcgcccgtgaactgctggtac
ctggtcctgcaccagacccggcgggagagccgggaccatgccaccctcaacgacatcttc
atgaacaacgtcatcgtccgcctgtcccagatcagcgaggatgtcatcaggctcttcaaa
aagagcaaggaaattgggctgcagatgcacgaggagctcctgaaggtcaccaacgagctg
tacacggtcatgaagacctaccacatgtaccacgcggagagcatcagtgccgagagcaag
ctgaaggaggctgagaagcaggaggagaagcagttcaacaagtcgggagagctcagcatg
aacctgctgcggcacgaggaccggccccagcgccgcagctctgtgaagaagatcgagaag
atgaaggagaagaggcaggccaagtactccgagaacaagctcaagtgcacgaaggcccgc
aacgactacttgctgaacctggcagccaccaacgcggcgatcagcaaatactacatccat
gacgtctccgacctgatcgattgctgcgatttgggctttcacgccagcctggcccgcacc
ttccggacctacctctcagcggaatacaacctggagacctcgcgccacgaggggctggac
gccatcgagagcgccgtggacagcctggattcccggagtgacaagcacacagtcatggac
atgtgcaaccaggtcttctgcccgccactcaagttcgagttccagccccacatgggggac
gaggtatgccaggtcagcgcccagcagcccgtgcagacggaattgctcatgcggcaccac
cagctgcagtccagactggccacgctcaggatagagaatgaggaggtgaggaagaccctg
gacgccaccatgcagaccctgcaggacatgctgaccgtggaggacttcgacgtgtccgac
gccttccagcacagccgctccacagaatccgtgaagtcggctgcctccgagacctacatg
agtaagatcaacatcgccaagaggagggccaaccagcaggagaccgaggtgttctacttc
acgaaatttaaggagtatgtgaacggcagtaacctcatcaccaagctccaggccaagcac
gccctactcaagcagacgctgggcgagggggagagagcagagtgtggcaccaccaggccc
ccctgcctgccccccaaaccacagaaaacgaggagacctaggcctctctcagtgtatagc
cataagctctttaacggcagtatggaagcgttcattaaggagtcaggacaagccataccg
ctcgtagtggagagctgcatccgatacatcaacttatatggactgcagcagcagggcatc
ttcagagtgcctgggtctcaggtcgaggtcaacgatatcaaaaattcctttgagagaggt
gaagaccccctcgtggacgaccaaaatgagcgagatatcaactcggtcgccggtgtctta
aaactgtatttccgaggactggaaaacccactctttcctaaggaaaggtttcaagacttg
atatctaccattaaactggagaccccagccgagagggtgcatcagatccagcagatcctc
gtcaccctgccccgcgccgtcatcgtggtcatgagatacctcttcgccttcctcaaccac
ctctcccagtacagcgacgagaacatgatggatccctacaacctggccatctgcttcggg
cccaccctcatgcacatcccagatgggcaggaccccgtgtcttgccaggcccacgtcaac
gaagtcatcaaaaccatcatcatccatcacgaagccatcttccccagcccccgggagctg
gagggccccgtgtacgagaagtgcatggctggaggggaggattactgtgacagcccgcac
agcgagccaggcaccatcgacgaagttgaccatgacaacggcaccgagccgcacaccagt
gacgaagaagtggagcagatcgaggccatcgccaagttcgactacgtgggccggtccccg
cgggagctgtccttcaagaagggggcctccctgctgctgtaccaccgcgcgtccgaggac
tggtgggagggccggcacaacggtgtggacggcctcatcccgcaccagtacatcgtggtg
caggacatggacgacgccttctccgacagcctgagccagaaggcggacagcgaggcgagc
agcgggcccctgctggacgacaaggcttcctccaagaacgacctgcagtcccccacagag
cacatctcggactatggctttggaggggtgatgggccgagtgcggttgcgatccgatgga
gcggccatccccaggcgccgaagcgggggtgacacgcacagcccgccccgcggcctgggc
cccagcctagacacgccgccccgggccgctgcctgccccagcagcccccacaaaatcccc
ctcccccgggggaggatcgagagccccgagaagcggaggatggcgacattcgggagcgcc
ggcagcatcaacttccccgacaagaaggcgctgtccgaagcgcactccatgaggtcgacc
tgcggctctaccaggcacagcagcctaggggaccacaagtccctggaggccgaggccctg
gccgaagacatcgagaagaccatgagcacggctctgcacgagctgcgggagctggaacgg
cagaacacggtcaagcaggcgccggacgtggtgctggacaccctggagcccctgaagaac
ccgccgggccccatcagctcggagccggccagcccgctgcacaccatcgtcatccgcgac
cccgacgccgccacgcgccgcagcagcagctcctccgccgagatgatgaccaccttcaag
ccggccctgtccgcgcgcctggccggcgcccagctgcgcccgccgcccatgcggcccgtg
cggcccgcggtgcagccccgctccagcagcagcagcagctcgggcgtgagcagcccggcc
gtgacgcccaccgagaagatgttccccaacagctcggcggacaagtccggcaccatgtga

DBGET integrated database retrieval system