KEGG   Oryctolagus cuniculus (rabbit): 100345909
Entry
100345909         CDS       T03373                                 
Symbol
ABL1
Name
(RefSeq) ABL proto-oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04110  Cell cycle
ocu04360  Axon guidance
ocu04722  Neurotrophin signaling pathway
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05220  Chronic myeloid leukemia
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100345909 (ABL1)
   04014 Ras signaling pathway
    100345909 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100345909 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100345909 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100345909 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345909 (ABL1)
   05206 MicroRNAs in cancer
    100345909 (ABL1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100345909 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100345909 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100345909 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100345909 (ABL1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100345909 (ABL1)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  ABL family
   100345909 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Haspin_kinase Kinase-like SH3_6 ABC1
Other DBs
NCBI-GeneID: 100345909
NCBI-ProteinID: XP_017195217
Ensembl: ENSOCUG00000007140
LinkDB
Position
Un
AA seq 1125 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKDSARHGGPHCNVFVEHEALQRPVASDFEPPG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHCTVADGLITTLHYPAPKRN
KPTVYGVSPSYDKWEMERTDIAMRHRLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWSPSDRPSFAEIHQAFETMFQESSISDEVEKELGRRGARGAASA
LLQAPELPTKTRTARRAADAADAPHSKGQGESDALDHEPAVSPLLPRKERGPPDGGLNED
ERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGPQERRGPGEDEGRDVSNGAPP
LAPSDATEPAKAPKASNGAGVPNGACREAGGSGFRSPHLWQKSSTMTGSRLAAGEEESGG
GSSKRFLRSCSASCVPHGAKDAEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRA
SENRCDQVTRGTVTPPPRLAKKSEEAGDEVFRDAAADGSPGSSPPGLTPKLQRRQVSVAA
ASAAPHKDEAGKGGALGTTAAATEPGPPPSRAASGAPGGPGKGPGEEPRVRRHKHASESP
GRDKGKLSKLKPAPPPPPAPVGRAGKPSQSPSQEAAGEAASCEATKPGQPGDSLKRPVLP
SVPKPQSGPKPSGTPANSAPTPASLPAAADQPSSTAFIPLISTRVSLRKTRQPPERIASG
TITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFRE
AINKLESNLRELQICPAAAGGGPAATQDFSKLLSSVREISDIVQR
NT seq 3378 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccagagaaggccgagtctgcccgccctg
cacttcatcaaaggagccggcaagaaggactcggcgcgccatgggggcccgcactgcaac
gtcttcgtggagcacgaagcccttcagaggccagtagcgtctgacttcgagcccccgggt
ctgagcgaggctgctcgctggaactccaaggaaaacctcctcgctgggcccagtgaaaat
gaccccaacctgttcgttgcactgtatgattttgtggccagtggagataacactctaagc
ataactaaaggtgaaaagctccgggtcttaggctacaatcacaatggcgagtggtgtgaa
gcccaaaccaaaaatggccaaggttgggtcccgagcaactacatcacgccggtcaacagc
ctggagaagcactcctggtaccacgggcccgtgtcccgcaacgccgccgagtacctgctg
agcagcgggatcaacggcagcttcctggtgcgggagagcgagagcagtcctggccagagg
tccatctcgctgagatatgaaggcagggtgtaccactacaggatcaacaccgcttctgat
ggcaagctctacgtctcctcggagagccgcttcaacaccctggcggagctggtccatcac
cactgcaccgtggccgacggcctcatcaccaccctgcactacccagcccccaagcgcaac
aagcccacggtgtacggcgtgtcccccagctacgacaagtgggagatggagcgcaccgac
atcgccatgcggcaccggctgggcggcggccagtacggggaggtgtacgagggcgtgtgg
aagaagtacagcctcacggtggccgtgaagaccttgaaggaggacaccatggaggtggaa
gagttcctgaaggaagccgcggtgatgaaggagatcaagcaccccaacctggtgcagctg
ctcggggtctgcacccgggagcccccgttctacataatcactgagttcatgacctatggg
aacctgctggactacttgcgagagtgtaatcggcaggaggtgaacgctgtggtgctgctc
tacatggccacgcagatctcgtcagccatggagtacctggagaagaagaacttcatccac
agggaccttgctgcccggaactgcctggtaggggaaaaccacttggtgaaggtggctgat
tttggcctgagcaggctgatgacaggggacacctacacggcccacgccggagccaagttt
cccatcaagtggaccgcgccggagagcctggcctacaacaagttctccatcaagtccgac
gtgtgggcgtttggagtgctgctttgggaaatcgccacctacggcatgtcgccgtacccg
gggatcgacctgtcccaggtctatgagctgctggagaaggattaccgcatggagcgcccg
gaaggctgcccggagaaggtctacgaactcatgcgagcatgttggcagtggagtccctca
gaccggccctcctttgctgaaatccaccaagcttttgaaacgatgttccaagaatccagt
atctcagatgaagtggaaaaggagctggggagacggggcgcacggggggccgcgagcgcc
ttgctgcaggccccagaactgcccaccaagaccagaaccgccaggagagccgccgacgcc
gccgacgcgccccactccaagggccagggcgagagcgatgccctggaccacgagcctgcc
gtgtctccactgctccctcggaaagagcgaggccccccggacggcggcctgaatgaggac
gagcgcctcctccccaaagacaagaagaccaacctgttcagcgccttgatcaagaagaag
aagaagacggctccgacgcccccgaagcgcagcagctccttccgagagatggacggcccg
caggagcgcaggggccccggcgaggacgagggccgggacgtcagcaacggggcgccgccc
ctcgccccctcagacgccaccgagccagccaaggcccccaaagccagcaacggcgccggc
gttcccaacggggcctgccgggaggccgggggctcgggcttccggtccccgcacctgtgg
cagaagtccagcacaatgaccggcagccgcttggcggccggtgaagaggagagcggcggc
ggctccagcaagcgcttcctgcgctcctgctccgcctcctgcgtgccgcacggggccaag
gacgcagagtggaggtcggtcacgctgccgcgggacctgcagtccaccgggaggcagttc
gactcgtccacgtttggaggacacaaaagcgaaaagccagctttgcctcggaagcgggcc
agcgagaacaggtgcgaccaggtgaccagaggcaccgtgacccccccgcccaggctggcg
aaaaagagcgaggaagccggggacgaggtcttcagagacgccgcggccgacggcagcccg
ggctccagccctcccggcctgactccgaagctccagcggcggcaggtctcggtggctgct
gcctctgcagccccccacaaggacgaggccgggaagggcggtgccctggggaccactgct
gccgccaccgagccagggccccctcccagcagggcagcgtcaggcgcgcctgggggcccc
ggcaagggccccggtgaggagccccgagtgaggaggcacaagcacgcctccgagtcaccg
gggagagacaaggggaagttgtccaagctcaaacccgccccgccgcctcccccagcccct
gtggggagagccgggaaaccctctcagagcccgagccaggaggcggctggggaggcagcg
agctgtgaggccaccaagcccggccagccaggggacagcctcaaaaggcctgtgctgccg
tccgtaccaaagccacagtcgggccccaagccctcggggacccccgccaactcggccccc
acccccgcctcgctgccggcagcggccgaccagccatcttccaccgcctttatcccgctc
atatccacgcgcgtgtctcttaggaaaacccgccagcccccagagcgcatcgccagcggc
accatcaccaagggcgtggttctggacagcaccgaggccctgtgcctggccatctccagg
aactcggagcagatggccagccacagcgccgtgctggaggccggcaaaaacctctacacg
ttctgcgtgagctacgtggattccatccagcagatgaggaacaagttcgccttccgagag
gccatcaacaaactggagagcaacctgcgggagctgcagatctgcccggcggcggcgggc
ggcggcccggcggccacgcaggacttcagcaagctgctcagctccgtgagggagatcagc
gacatcgtgcagaggtag

DBGET integrated database retrieval system