KEGG   Oryctolagus cuniculus (rabbit): 100346109
Entry
100346109         CDS       T03373                                 
Symbol
TLR9
Name
(RefSeq) toll like receptor 9
  KO
K10161  toll-like receptor 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04620  Toll-like receptor signaling pathway
ocu05132  Salmonella infection
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05152  Tuberculosis
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100346109 (TLR9)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100346109 (TLR9)
  09172 Infectious disease: viral
   05162 Measles
    100346109 (TLR9)
   05168 Herpes simplex virus 1 infection
    100346109 (TLR9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100346109 (TLR9)
   05152 Tuberculosis
    100346109 (TLR9)
  09174 Infectious disease: parasitic
   05144 Malaria
    100346109 (TLR9)
   05142 Chagas disease
    100346109 (TLR9)
   05143 African trypanosomiasis
    100346109 (TLR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100346109 (TLR9)
   04090 CD molecules [BR:ocu04090]
    100346109 (TLR9)
Pattern recognition receptors [BR:ocu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100346109 (TLR9)
CD molecules [BR:ocu04090]
 Proteins
  100346109 (TLR9)
SSDB
Motif
Pfam: LRR_8 LRR_4 Cofilin_ADF LRR_12 TIR LRR_6 LRR_9 TIR_2
Other DBs
NCBI-GeneID: 100346109
NCBI-ProteinID: XP_008258980
LinkDB
Position
9:complement(19296817..19313018)
AA seq 1321 aa
MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLMLGASREPVGRWDQDYDRAVLPL
LDAQQPCYLLYRLDSHNAQGFEWIFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDE
LFGTVKDDLSLAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKRQTLQGLAF
PLQPEAQRAIQQLRQKTINYIQLKLDLERETIELVHTEPTDVAQLPSRVPRDSARYHFFL
YKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLLDSVEQDFQLQISKKCPCRGA
PWPLSLLVQAMVLAAARALGTLPVFLPCELKPHGLVNCDWLYLKSVPRFSAAAPHGNVTS
LSLASNRIHHLRDADFAQLSSLRHLSLQWNCPPVSLSPMRFSCHMTIEPNTFLAVPTLED
LNLSFNAITTVPALPSALVKLSLSHTNIVVLDLTRFAGLDALRSLILDGNCYYKNPCGKA
PVVSGPPHGLGNLTHLSLMYNNLTQVPRELPPSLEFLLLSYNRIVQLEPEDLAGLRALRV
LDVGGNCRRCDHARNPCEECPRRSLSLHPNTFSHLRHLEGLVLKDSSLHTLDPRWFHGLG
NLTTLDLSENYLYFCITDTTAFQGLARLRRLDLSFNYHKKSSFAQLRLAPSFGSLLSLQE
LDVHGIFFRSLSEDTLQPLLRLPQLRRLHLQTNFITQAWLGVFGAFQGLSFVDLSDNRIS
GASGPAATAGETGGTQQVWLPSADWAPVTGGGRGSEDFMPHCSRFNFTLDLSRNNLVEVQ
PEVFAGLSNLQCLRLSHNNIAQVVNGSQFLPLTSLQVLDLSHNKVDLYHGRSFTELPRLE
ALDLSHNRQPFSMRGVGHNLSFVAQLPTLRYLSLAHNGIGGRVSPQLHSTSLRALDFSGN
ILSRMWAEGDLYLHFFRGLRGLLRLDLSQNHLHTLLPRWLGSLPKSLRLLRLRDNSMGFF
NWTALALLPNLEALDLAGNHLKLLANGSLPNGTRLQRLDLSCNRIRSVAPGFFALAVELR
QLNLSNNALQTIRSSWFGPLAGALQLLDVSANPLHCTCGAAFLDFLLEVQAAVPRLPXAV
QCGSPRQLQGLSIFAQDLRFCKDEALSRACFGFSLLAVALGLAVPMLHHLCGWDVWYCFY
LVLAWLPWRRRWAVDALPYDAFVVFDKAESAVADWVYNELRGQLEERRGRRALRLCLEER
DWLPGQSLIENLWASVYSSRKTLFVLAHSDRLSGILRASFLLAQQRLLEERKDVVVLVLL
HPPAHRSRYVRLRQRLCRRSVLLWPRQPSGQGSFWAQLSTALTRDNSHFYNRNFCRGPTA
E
NT seq 3966 nt   +upstreamnt  +downstreamnt
atggcgcaccagacgggcatccacgccacagaggagctgaaggaattctttgccaaggca
cgggctggctctgtccggctcatcaaagtcgtcattgaggacgagcagctcatgctgggt
gcctcgcgggagccggtgggccgctgggaccaggactatgaccgggccgtgctgccgctg
ctggacgcccagcagccctgctacctgctgtaccgcctcgactcgcacaatgctcagggc
ttcgagtggatcttcctcgcctggtcgcctgataattcccctgtgcggctgaagatgctg
tatgcagccacacgggccacagtgaaaaaggagtttggaggcggccacatcaaggatgag
ctctttgggaccgtgaaggatgacctctccttggctgggtaccagaagcacctgtcatcc
tgtgcggcacccgccccgctgacctcagcggagagggagctgcagcagatccgtatcaat
gaggtgaagacagagatcagcgtggaaagcaagcggcagaccctgcagggcctcgccttc
cccctgcagcccgaggcccagcgggcgatccagcagctcagacagaagaccatcaactat
atccagctgaagctggacctagagcgggagaccatagagttggtgcacacggagcccaca
gacgtggcccagctgccctcgcgagtgcccagggactctgcccgctaccacttctttctc
tacaagcacacccatgagggcgaccccctggagtccgtggtgttcatctactccatgccg
gggtacaagtgcagcattaaggagcgcatgctctactccagctgcaagagccgcctcctg
gactccgtagagcaggacttccagctgcagatctccaagaagtgtccctgtcgaggagcc
ccgtggcccctgtcgctgctggtgcaggccatggtgctggctgcggcccgggccctgggc
accctgcctgtcttcctgccctgcgagctgaagccccacggcctggtgaactgcgactgg
ctgtacctgaagtccgtaccccgcttctcggcagcagcaccccacggcaacgtcaccagc
ctttccctggcctccaaccgcatccaccacctgcgcgacgccgacttcgcccagctgtcc
agcctgcggcatctcagcctccagtggaactgcccgccagtcagcctcagccccatgcgc
ttctcctgccacatgaccatcgagcccaacaccttcctggccgtgcccaccctggaggac
ctgaatctgagcttcaatgccatcactactgtgcccgccctgcccagcgccctcgtgaag
ctgtccctgagccacaccaacatcgtggtactggacctcaccaggtttgctggcctggat
gcgctccgctccctgatcctggacggcaactgctactacaagaacccctgtgggaaggcc
cctgtggtctcggggcccccgcatggcctgggcaacctcacccacctgtcactcatgtac
aacaacctcacgcaggtgccccgcgagctgccgcccagcctggagttcctgctcttgtcc
tacaaccgcattgtgcaactggagcctgaggacctggccgggctgagggccctgcgcgtg
ctggacgtgggcgggaactgccgacgctgtgaccacgcccgcaacccctgcgaggagtgc
ccccgccgctccctctccctgcaccccaacaccttcagccacctgaggcatctggaaggc
ctggtgttgaaggacagctccctgcacacgctggaccccagatggttccacggtctgggc
aacctcaccacgttggacctgagcgagaactacctgtacttctgcatcacggacaccaca
gccttccagggcctggcccggctgcgccgactcgacctgtcctttaactaccacaagaag
tcgtcctttgcccagctgcggctggcgccgtcctttgggagcctgctgtccctgcaggag
ctggatgtgcacggcatcttcttccgctcgctcagcgaggacacgctccagccgctgctc
cgcctgccccagctccggaggctgcacctgcaaaccaacttcatcacccaggcctggctc
ggcgtcttcggggccttccagggcctgagcttcgtggacctgtcggacaaccgcatcagc
ggggcttccgggccggcggccaccgcgggggagacaggtggcacgcagcaggtctggctg
ccgtccgctgactgggctccagtcactgggggcggccgcggctctgaggacttcatgccc
cactgtagcaggttcaacttcaccttggacctgtcccgtaacaacctggtggaggtccag
ccggaggtgttcgcagggctctcgaacctccagtgcctgcgcctgagccacaacaacatc
gcgcaggtagtcaacggctcgcagttcctgccgctgaccagccttcaggtgctggacctg
tcccacaacaaggtggacctgtaccatgggcgctcgttcacggagctgccgcgcctggag
gccctggacctcagccacaaccggcagcccttcagcatgcggggcgtgggccacaacctc
agcttcgtggcccagctgcccaccctgcgctacctgagcctggcccacaacggcatcggc
ggccgcgtgtccccgcagctccacagcacctcgctgcgggcgctggacttcagcggcaac
atcctcagccggatgtgggccgagggagacctctacctgcacttcttccgaggcctgagg
ggcctgctccggctggacctgtcccagaatcacctgcacaccctcctgcccagatggctg
ggcagcctccccaagagcctgcgcctcctgcggctccgagacaactccatgggcttcttc
aactggacggcgctggccctcctgcccaacctggaagctctggacctggcaggaaaccac
ctgaagctgctggccaatggcagcctgcccaacggcacccggctgcagaggctggacctc
agctgcaacagaatccgctctgtggcccccggcttctttgccctggccgtggagctgcga
cagctgaacctcagcaacaacgccctccagaccatccgctcgtcctggttcgggcccctg
gcgggcgccctgcagctgctggacgtgagcgccaaccctctgcactgcacctgtggcgcg
gccttcctggacttcctgctggaggtgcaggctgccgtgcccaggctccccnatgccgtg
cagtgtggcagcccgcgccagctgcagggcctcagcatctttgctcaggacttgcgcttc
tgcaaggatgaggccctctcgcgggcctgctttggcttctcgctgctggcagtggccctg
ggcctggccgtgcccatgctgcaccacctctgtggatgggacgtctggtactgcttctac
ctggtgctggcctggctcccctggcggcgacggtgggctgtggacgccctgccctacgat
gcctttgtggtcttcgacaaggcagagagcgccgtggccgactgggtgtacaacgagctg
cgggggcagctggaggagcgccgtgggcgccgagcgctgcgcctgtgcctggaggagcgg
gactggctgcctggccagtcgctcatcgagaacctgtgggcctcagtctacagcagccgc
aagacactgtttgtgctggcccacagcgaccggctcagtggcatcttgcgtgccagcttc
ctgctggcccagcagcgcctgctggaggagcgcaaggacgtggtagtgctggtgctgctg
cacccgcccgcccaccgctcccgctacgtgcggctgcgccagcgcctctgccgccgcagc
gtcctcctctggcctcgccagcccagcggccagggcagcttctgggcccagctgagcacg
gccctgaccagggacaacagccatttctataaccggaacttctgccgggggcccacagct
gaatag

DBGET integrated database retrieval system