KEGG   Oryctolagus cuniculus (rabbit): 100346128
Entry
100346128         CDS       T03373                                 

Symbol
STAM
Name
(RefSeq) signal transducing adaptor molecule
  KO
K04705  signal transducing adaptor molecule
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100346128 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100346128 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100346128 (STAM)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100346128 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 100346128
NCBI-ProteinID: XP_008266517
Ensembl: ENSOCUG00000003771
UniProt: G1SKD5
LinkDB
Position
16
AA seq 537 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYMQSSGVSASQVYPGPPQSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQGAVPPSANPALPGQQTHAAYPNTMVSSVQGSTYPSQASVY
SPPPAAATAADVTMYQNAGTNLSQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgaccaggatgttgagaaagcaaccagtgaaatg
aatactgctgaggactggggactcattttggatatttgtgataaagttggtcagtctcgc
actggacctaaagattgtcttcggtctattatgaggagggtgaatcataaagatcctcat
gttgctatgcaagctttgactcttctaggagcatgtgtgtcaaactgtggcaaaattttt
catttagaagtgtgctcaagagatttcgctagtgaagtaagcaatgtgttaaataagggt
catccaaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccgcagcttagcctgatatcagcaatgattaagaaccttaaagaacaaggagtt
acgttcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctctggta
gccaaggatcctggtactgtggcaaacaaaaaggaagaagaagatttagcaaaagccatt
gagttgtcattgaaggaacaaaggcagcagtccaccactctttccaccttgtatccgagc
acatccagtctcttaactaaccaccaacacgaaggccgaaaagtccgtgctatatatgac
tttgaagctgctgaagataatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcccaattggtggaaaggtgaaacccatcaaggcgtagggttattccca
tctaattttgtgactgcagatctcactgctgagccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgacgttcaggtagagacaatagagccagagccggaaccagcc
tttattgatgaagataaaatggatcagttgctacagatgttgcaaagtacagatcccagt
gatgatcagccagatcttccagagctgcttcatctggaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctagaagatattgatagaaaacattcagaactctcagaactt
aatgttaaagtgatggaggcactttcattgtataccaagttaatgaatgaagatccgatg
tattctatgtatgcaaaattacagaatcagcagtattatatgcagtcatctggtgtttct
gcttctcaggtatatccagggcctccacagagtggtgcttacctggttgcagggaatgca
cagatgagccatcttcagagctacagccttccccccgagcaactgtcttctctcagccag
ggagcggttccaccatctgcaaacccagcccttcctggtcagcagacccacgctgcttac
ccgaacacaatggttagttctgttcaaggaagtacgtatcccagccaggcttcggtatat
agtcctcctcctgctgctgccactgctgctgatgtcactatgtaccagaatgcaggaact
aatttgtcccaggtgccaaactataatttaacatcatcaacactgcctcagccaggaggc
agccagcagccacctcagccacaacaaccatattctcagaaggctctgctatag

KEGG   Oryctolagus cuniculus (rabbit): 100351322
Entry
100351322         CDS       T03373                                 

Symbol
STAM2
Name
(RefSeq) signal transducing adaptor molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100351322 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351322 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351322 (STAM2)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100351322 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH MerR-DNA-bind
Other DBs
NCBI-GeneID: 100351322
NCBI-ProteinID: XP_008256805
Ensembl: ENSOCUG00000000344
LinkDB
Position
7
AA seq 597 aa
MPAGRRPKSGVGGGAPAGSPSGRQASGRPAGGRTGRASGAESSRKPRSRVSRRGGAAETQ
PDRRDADPDAGEMPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLK
AIMKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEK
LKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPLAGSQTSSAAAKNGTSSDKTREDE
DIAKAIELSLQEQKQQHTETKSLYPAAEIQLNNKVARKVRALYDFEAVEDNELTFKHGEI
IIVLDDSDANWWRGENHRGIGLFPSNFVTSNLNIESEAAAVDKLNVIDDDVEEIKKSEPE
PVYIDEDKMDRALRVLQSIDPTDSRPDSQDLLDLEDTCQQMGPMIDEKLEEIDRKHSELS
ELNVKVLEALELYNRLVNEAPLYSVYSKLHPPAHYPPTSAAVPMQAYPVQPHGGNYMDQS
IHQVTAAHSYSLGPDQISSLRSLPPNVNSSVATQTAQTPYLSTGQDTASNPTYMNQNSNL
QSAPGSAAYTQQVGMSVDMSSYQNATSSLPQLAAFPVAAPAHSVAQQQTNYHQQPLL
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgccggcgggacgtcgtcccaaaagcggagtcgggggcggagcgcccgctggcagcccg
tcaggcaggcaggcgtcaggccggcccgcgggcggaagaacggggcgggcgtccggagcg
gagtcgtctaggaagccgcggtcccgggtcagccggcggggaggagctgctgagacccag
ccagaccgcagggacgcggacccggacgccggcgagatgccactgttcaccgccaacccc
ttcgagcaggacgtggaaaaagccacgaatgagtacaacaccacagaagattggagtctt
attatggacatatgtgacaaagttggaagcactcctaatggagcaaaagattgcctgaaa
gccataatgaaaagagtaaatcataaggttcctcacgttgctctgcaggcgttaactctt
cttggggcttgtgtggcaaactgtggaaagatatttcacctagaagtatgttcccgtgat
tttgcaacagaagtacgtgctgtgataaaaaataaggctcacccaaaagtatgtgaaaaa
ctgaaatctttgatggtagagtggtcagaagaatttcaaaaggaccctcagtttagtctt
atatctgcaactattaaatctatgaaagaagaaggaattacttttcctttagcaggatca
cagacttcctcagctgctgccaagaatggtacgtcatcagacaaaaccagagaagatgaa
gacatagctaaagctattgaattatcattgcaagaacagaagcagcaacacacagagaca
aaatccttgtatccagctgcagaaattcagttaaataataaggttgcacggaaagtgaga
gccttatatgattttgaagccgttgaggacaatgaactcacctttaaacatggtgaaatc
attattgttttggatgacagtgatgccaattggtggagaggagaaaatcacagaggaata
ggactctttccatctaattttgtcacatctaatttaaacatagaatctgaggcagcagct
gtggacaaattgaatgtaattgatgatgatgtggaggaaattaagaaatcagagcctgag
cctgtttatatagatgaggataagatggatagagcactgcgggtactccagagtatagat
ccgacagactcaagacctgactcccaagacctcttggacttagaagatacctgccagcag
atgggtccaatgatagatgaaaaacttgaagaaattgataggaaacattccgagttgtct
gaattgaatgtgaaagtgttggaagctctggaactgtataacagattggtgaatgaagca
ccactgtattcagtctactcaaagctccatcctccagcacattacccacctacgtcagct
gcagtcccaatgcaggcatatccggttcagccacatggaggaaactacatggatcagagc
attcaccaggtgactgctgcccacagctacagcctaggaccagatcagatcagttccttg
cgatctctgcctccaaatgtgaattcctcagtagcaacacagactgctcaaactccgtat
ttaagcactggacaagacactgcttccaatcctacctatatgaaccagaactctaacctt
caatcagctcctggctcagctgcgtacacccagcaagtggggatgtctgtggatatgtca
tcctaccagaacgctacctccagcttgccacagctggcggcctttcctgtggcggcccca
gctcattcagttgcacagcagcaaacaaattaccatcagcagcctctcctttag

DBGET integrated database retrieval system