KEGG   Oryctolagus cuniculus (rabbit): 100346534
Entry
100346534         CDS       T03373                                 
Symbol
GDF3
Name
(RefSeq) growth differentiation factor 3
  KO
K22672  growth differentiation factor 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100346534 (GDF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100346534 (GDF3)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100346534 (GDF3)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100346534
NCBI-ProteinID: XP_002712811
Ensembl: ENSOCUG00000013747
UniProt: G1T618
LinkDB
Position
8:33883840..33892515
AA seq 365 aa
MPPSLSVLALGFLLTLALGQTFHFQENLFLQFLVLDKMPSPEKFQPVPSILKKIVQDREA
EAAAGVAQDLCYVKELGVRGNMLRLLADRGFFLYSKKLSQDNFCLQKLLYFNLSAISREE
QLTMARLGLDLGPNSYYNLGPDLEVSLSVAREPHVSGRSFPKPGRRMALQSVPRPQGALH
FNLLDMAQDWNNNPQKNLGLFLEILVREDRGSGVHFQLEDTCARLRRSLHASLLVVTLNP
AQCHLSSRKRRAASPAASPACRSLCHRHQLFINFRDLGWHKWIIAPRGFMANYCHGECPF
SLTTSLNSSSYAFMQALMRAVDPQVPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVD
ECGCG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcctccttccctgtcagtcttggctctcggcttcctgctaactctggccttgggccag
acattccactttcaagaaaatttgtttctgcagtttctggtcttagacaagatgccttca
cccgagaagttccaacccgtgccttccatcttgaagaagattgtccaggaccgagaggca
gaagcagccgccggggtcgcccaggacttgtgctacgtcaaggagctgggtgtccgtggg
aacatgcttcgacttctcgcggaccgcggtttctttctttactccaagaaactttcccaa
gacaacttttgcctacaaaagcttctttactttaacctctctgccatcagcagagaggaa
cagctaacaatggcccggctgggcctggacttggggcccaattcttattataacctagga
ccagacctggaagtgtctctgtctgtggctcgggagcctcatgtgagcggccggtccttc
cctaagccgggtagaaggatggcattgcagtcagtaccacggcctcaaggtgctcttcat
ttcaacctgctggatatggctcaggactggaacaacaacccacagaagaacctgggctta
ttcctggagatactcgtcagagaagacagaggttctggggttcattttcagcttgaggac
acctgtgccagactgagacgctcccttcatgcttctctgctggtggtgaccctcaaccct
gcacagtgccacctttcttcccggaagaggagggcagccagccctgccgccagccctgcc
tgcaggagcctctgccaccgtcaccagctattcatcaacttccgggacctgggttggcat
aagtggatcattgcgcctagggggttcatggcaaattactgccatggggagtgtcctttc
tcactgaccacctctctcaacagctccagctacgccttcatgcaagcactgatgcgtgcc
gtcgacccgcaggtcccccaggctgtctgtatccccaccaagctgtctcccatttccatg
ctgtaccaggacaacaatgacaacgtcatcctacggcattatgaagacatggtggttgat
gaatgtgggtgtgggtag

KEGG   Oryctolagus cuniculus (rabbit): 103349623
Entry
103349623         CDS       T03373                                 
Name
(RefSeq) nodal homolog 2-A
  KO
K22672  growth differentiation factor 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349623
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103349623
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 103349623
NCBI-ProteinID: XP_008260450
LinkDB
Position
11:complement(72669324..72672508)
AA seq 330 aa
MEGSGQGRGCSWLLSGLLALGFLCMHFSWVEPLDCAARILPSRVNEIFVARQHGFTLTSK
SAQFLHSYWLLYFEAAPFVGISLVQLWAWVPNAPHATELILEFKDHRRGPSKFLLGSFPV
IFSSYHSETGSLLEIYCLLTYWMEVVPTLLTEEKIPSTDVADVRLNECSSTQGKRDMVLL
FISSAFSQPPLFHLPYVQEPFIANVEQLILGTPGQNPWDVDPGQTPLPAEKLCHLVDRKV
NLHRATWGECIVAPKTFSSPHCQGTCLALNSEFHQPNLECHKRDAPTCPQLFRACVPTKV
RLLSLMVQDDEHKMSVHHVNTSLIEKCGCS
NT seq 993 nt   +upstreamnt  +downstreamnt
atggaaggcagtggccaggggaggggctgctcgtggcttctttctgggctcttagccctg
gggttcttgtgcatgcattttagctgggtggaacctttggattgtgctgcccggattctg
ccttcccgtgtgaatgagatctttgttgccaggcaacatggctttactctcacatccaaa
agtgcccagttcctacacagctactggcttctctacttcgaggcagctcccttcgtgggg
atttccttggtacagctgtgggcctgggtacccaacgccccgcatgctactgagcttatt
ctggagttcaaggatcatcggaggggcccctccaaattcctcctgggctctttccccgtt
atcttctcatcttatcactcagagactggatctttactggagatctactgtttactaaca
tattggatggaggtggtgcctaccctcttgacagaagaaaagattccatccactgatgtg
gccgatgtccgcctgaatgagtgttccagcacccaaggcaagcgagatatggtgctgctg
ttcatatcttcagccttcagccagccgcctctgtttcacctgccttacgtccaggagccc
ttcatcgctaacgtggaacagctgatcctgggaacgccgggccagaatccctgggacgta
gacccgggccagactccacttccagcagagaagctctgtcacctggtggatcgcaaggtg
aaccttcacagagctacctggggcgagtgtattgtcgcccccaagactttcagctcccct
cactgtcagggaacctgcctggccctgaacagtgagttccatcagcccaaccttgagtgc
cacaagagggatgcacccacctgtccccagctcttccgggcctgtgttcccaccaaggtc
aggctcctctccttgatggtccaggatgacgaacacaagatgagtgtgcaccatgtgaac
acatccctgatagaaaagtgtggttgctcttga

DBGET integrated database retrieval system