KEGG   Oryctolagus cuniculus (rabbit): 100346617
Entry
100346617         CDS       T03373                                 
Symbol
PLXNC1
Name
(RefSeq) plexin C1
  KO
K06572  plexin C
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100346617 (PLXNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100346617 (PLXNC1)
CD molecules [BR:ocu04090]
 Proteins
  100346617 (PLXNC1)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG PSI Sema
Other DBs
NCBI-GeneID: 100346617
NCBI-ProteinID: XP_008255108
Ensembl: ENSOCUG00000016904
LinkDB
Position
4:73487978..73644654
AA seq 1572 aa
LLPPPPPPPRPPRPAASLPLLAYLLALAAAAPARGAGEPVWRSEQAIGAIAASRADGVFV
ASGSCLDQLDYSLQHRISRLYRDQAGNCTEPVPLAPPARPRPGSSFSKLLLPYREGAAGP
GGLLLTGWTFDRGACEVRPLGNLSRSSLRNGTEVVSCHPQGSTAGVVYRAGHRNRWYLAV
AATYVLPEPETASRCNPAASDRDTAIALKDTEGRSLATEELGRLKLREGAGSLHFVDAFL
WNGSVYFPYYPYNYTSGAATGWPSMARIAQSAEVQFQGQAALDCGHGHPDGRRLLLSSSL
VEALDVWAGVFSAATGEGQERRSPATTALCLFRMSEIQARAKSCSWDFQTSEHNCKEGDQ
PARVQPIASATLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVVLGENLTSNCPEVIYEI
KEETPVFYKLVPDPVKNVFIYLTAGKEVRRIPVANCSKRKSCSACLAAADPHCGWCLSQQ
RCTFQGDCTHSENLDNWLGVSSGGKKCPKVQIVRSNKDKTTVTVLGSSSPRHSQCVVRNL
DSGKDLCRGRSPANRPCTCTIPTRPTYRDVLAVSVTFSFGSWNLSERFNFTNCSSLRECP
VCVGTGCTWCKSGRKCIHPFTACDPSDYERNQELCPAAVETSPTTPGGGRLGEGRNSSTN
PGFQVFYVKSIEPQKISTLGKSNVIVTGANFTRASNITMILQGTSTCDNDVIRVSHVLND
THMKFSLPSSRKEMKHVCIQFDGGNCSPVGPLSYIALPHCSLLFPATTWISGGQNITIMG
RNFDVIDNLIISHELKGNINVSEYCVTTHCRFLAPNLKSAKARTNVTVKLRVQDTYLDCG
TLQYLEDPRFTGYRVDSEVDTELAVKIQKENDNFNISKRDIEITLFHGENGQLNCSFENI
TRNQDLTTILCKVKDITAANSIATSSRKVRVKLGNLELFVEQESVPSTWYFLIVLPVLLV
IVIFAAVGVTRHKSQELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFL
DYKHFALRTFFPESGGFTHIFTEDMHNRDANDKSESLTALDALICNKSFLVTVIHTLEKQ
KNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQSSNLQPKLMLRRTESVVEKL
LTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEF
STVALNVIFEKIPENESADVCRNISVTVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEI
GLELQVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYS
DDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLP
NSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTP
HIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLS
SLEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLHVK
VLFDEKKKCKWM
NT seq 4721 nt   +upstreamnt  +downstreamnt
tgctgctgccgccgccgccgccaccgccgcgccccccgcgccccgccgcgtcgctgcccc
tgctcgcctatctgctggcgctggcggcggcggcgcccgcccggggcgcgggcgagcccg
tgtggcgctccgagcaagccatcggagccatcgcggcgagcagggcggacggcgtgttcg
tggcgagcggcagctgcctggaccagctggactatagcctgcagcaccggatctcgcgcc
tgtaccgggaccaggcgggcaactgcacggagccagtcccgctggcgccccccgcgcggc
cccggcccgggagcagcttcagcaagctgctgctgccctaccgcgagggggcggcgggcc
ccggggggctgctgctcaccggctggaccttcgaccgcggcgcctgcgaggtgcggcccc
tgggcaacctgagccgcagctcgctgcgcaacggcaccgaggtggtgtcgtgtcacccgc
agggctcgacggccggcgtggtgtatcgcgcgggccacaggaaccgctggtacctggcgg
tggccgccacctacgtcctgcccgagcccgagaccgcgagccgctgcaaccctgcggcgt
ccgaccgcgacacggccatcgcgctcaaggacacggaggggcgcagcctggccacagagg
agctgggccgcctgaagctgcgcgagggcgcgggcagcctgcacttcgtggacgcctttc
tgtggaacggcagcgtctacttcccctactacccctacaactacacgagcggcgcggcca
ccggctggcccagcatggcgcgcatcgcgcagagcgccgaggtgcagttccagggccagg
cggccctcgactgcggccacggccaccccgacggccgccgcctgctcctctcctccagcc
tggtggaggccctggacgtctgggcgggcgtgttcagcgcggccaccggagagggccagg
agaggcgctcccccgccaccacggcgctctgcctcttcaggatgagtgagatccaggcgc
gcgccaagagctgcagctgggacttccagacgagcgagcacaactgcaaagaaggggatc
agcccgcccgagtgcagcccatcgcttcggccaccttgatccactccgacctgacatccg
tgtacggcaccgtggtgatgaacaggactgtcttgttcctggggactggagatggccagt
tacttaaggttgttcttggtgagaatttgacttcaaattgtccagaagttatctatgaaa
ttaaagaagaaactcctgttttctacaaacttgttcccgatcccgtgaagaatgtgttca
tctatctaacagccgggaaagaggtcaggagaattcctgtcgcgaactgcagcaagcgga
agtcctgctctgcgtgcctggcagcagcagaccctcactgcggctggtgcctctcgcagc
aaaggtgtacttttcaaggagattgcacacattcagagaacttagacaactggctgggtg
tttcctctggagggaaaaagtgtcccaaagtgcaaatagttcgaagcaacaaagataaga
ctacagtgaccgtgctggggagctcctcccccagacactcgcagtgcgtggtgaggaacc
tggatagtggcaaggacctgtgccgcgggaggagtcctgcaaaccggccgtgtacctgca
ccatccccaccaggccgacctacagagatgttctggctgtcagcgtgacgttctccttcg
gttcttggaatttgtcagaaagattcaactttaccaactgctcatccttaagagaatgtc
cagtgtgcgttggaaccggctgcacgtggtgtaagagtgggcgaaagtgcatccacccct
tcacagcctgtgacccttctgactatgagagaaaccaggagctctgtccggctgctgttg
agacgtcacccaccacgccaggaggaggaagactcggggagggcagaaatagcagcacca
acccaggctttcaggtcttctacgttaaatccattgagccccagaagatatcgaccttgg
ggaaaagcaacgtgatagttacaggagcaaacttcacccgggcgtccaacatcacaatga
tcctgcaaggaaccagtacttgcgataacgatgtgatccgggtgagccacgtgctaaatg
acacccatatgaaattctcgcttccgtcaagccggaaagagatgaagcacgtgtgtatcc
agttcgatggtgggaactgctctcccgtgggacccctgtcctacatcgccctcccgcact
gctccctgctatttcctgccaccacctggatcagtggtggtcaaaatatcaccatcatgg
gcagaaattttgatgtcattgacaacttaatcatttctcatgagttaaaagggaacataa
acgtctctgagtactgcgtgacgactcactgcaggtttttagcccccaatttaaagagcg
caaaagcgcgcacgaatgtcacggtgaagctgagagtgcaagacacttacctggactgtg
ggaccttgcagtacctcgaggacccccgatttacagggtaccgagtggattcggaggtgg
acacagaattggcagtaaaaattcaaaaagaaaatgacaacttcaacatttctaagcgag
acattgagattaccctcttccacggggaaaacgggcagttgaattgcagttttgaaaaca
ttacgagaaaccaggatctcaccaccattctttgcaaagtcaaagacatcactgcggcga
acagcatcgccacctcgtccaggaaagttcgcgtcaagctggggaacctggagctgtttg
tggagcaggagtcggtcccctccacgtggtattttctgatcgtgctccccgtcttgctgg
tgatcgtcatttttgcggccgtgggggtgacccggcacaaatcccaggagctgagtcgca
agcagagccaacagctggagctactggagagcgagctccgcaaagagatccgtgatggct
ttgctgagctgcagatggataaattggacgtggttgatagttttggaactgttcccttcc
ttgactacaaacattttgctctgaggactttcttccccgagtcaggcggcttcacccaca
tcttcaccgaagatatgcataacagagacgccaatgacaagagtgaaagcctcacagctc
tggacgctctcatctgtaataagagtttccttgttacggtcatccacacccttgaaaagc
agaagaacttctcagtcaaggacaggtgcctgtttgcctccttcttaaccatcgcactgc
aaaccaagctggtctacctgaccagcatcctggaggtgctgacccgggatctgatggagc
agtccagtaacttgcagcccaaactcatgctcaggcgcacagagtccgtggtcgaaaaac
tgctcaccaactggatgtccgtctgcctgtccggcttcctccgggagacggttggagagc
ccttctatctgctggtgacgactctgaaccagaaaatcaacaaggggcccgtcgatgtca
tcacttgcaaagccctgtacaccctcaacgaggactggctgctgtggcaggttccggagt
tcagcaccgtggcactcaacgtcatctttgaaaaaatcccagaaaatgagagcgcagatg
tctgtcggaatatttcggtcactgttctcgattgcgataccataggccaagccaaagaaa
agattttccaggcattcctcagcaagaatggctctccctatggacttcagctcaatgaaa
tcgggctcgagcttcaggtgggcacacgccaaaaagaacttctggatattgacagttcct
ccgtgattcttgaggatggaataaccaagctgaacaccattggccactatgagatatcga
atggatccactataaaagtctttaagaagatagcgaattttacttcagatgtggaatatt
cagatgaccactgccatttgattttaccagattcggaagccttccaagatgttcaaggaa
agagacatagagggaaacacaagttcaaagtaaaagaaatgtatctgacaaagctgctgt
cgaccaaggtggcaattcactctgtgcttgaaaaactattccgaagcatttggagtttac
ctaacagcagagccccatttgctataaaatacttctttgactttttggatgcccaggctg
aaaacaaaaaaatcacagatcctgatgttgtacatatttggaaaacaaacagccttcctc
tgcgcttctgggtaaacatcctgaagaaccctcagtttgtctttgacattaagaagacgc
cacacatagacggctgcttgtcagtgattgcccaggcattcatggacgcgttttctctca
cggagcagcagctggggaaggaagcaccaactaataaacttctctatgccaaggatatcc
caacctacaaagaggaagtaaaatcttactacaaagcaatcagggatttgcctccattgt
catcattagaaatggaagaattcttaactcaggaatctaagaaacatgaaaatgaattta
atgaagaagtggccttgacagaaatctacaaatacatcgtaaagtattttgatgagattc
taaataaactagagagagaacgagggctggaagaagcacagaaacaactcttgcatgtta
aagtcttatttgatgaaaagaagaaatgcaagtggatgtaa

DBGET integrated database retrieval system