KEGG   Oryctolagus cuniculus (rabbit): 100346676
Entry
100346676         CDS       T03373                                 
Symbol
CSF2RA
Name
(RefSeq) colony stimulating factor 2 receptor alpha subunit
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100346676 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100346676 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100346676 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346676 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100346676 (CSF2RA)
   04090 CD molecules [BR:ocu04090]
    100346676 (CSF2RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL3 receptor family
   100346676 (CSF2RA)
CD molecules [BR:ocu04090]
 Proteins
  100346676 (CSF2RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 100346676
NCBI-ProteinID: XP_008249541
Ensembl: ENSOCUG00000023225
LinkDB
Position
Un
AA seq 425 aa
MAPALGVFTDVLMIFLVLSTWPTPAFFQIQGDPEVEGAYPSLNVTFNSRTMNLSWDCPEN
MTEARCLLRHEETGKIIMKVSRMGCSCTFTSMTLHAGATLEVQVTAHQRHLRETLVYANT
GVEGTAARNFSCFIYDADFLNCTWARGPVAPVDTQYFLFLQDSRSQGKRETECPGYLKEA
GTNLGCHLHGLSRWPFYTYFLVNGSSRHMHIQFFDAILSTKEIERFSPPANTSVHCNESH
CLIQWLQPKTQQRLSYLDFQYQLDIQKEVCGVSSEVPKNMEPGSWNPLVEVSGASENKYN
FPSLQPRVRHWVRVRAADARVLGWSPWSQPVHFGSDTEDGGLLRVSLLVVLGTLVCTLVL
GFLAKRFFKMCGLLSPIPHVKDKLNDQQDLEHQVAWDEFPVGSGKCENEEVLTVQDAGQA
LGARA
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctcccgctctaggtgtcttcacagatgtcctgatgatattccttgtgctatccacc
tggcctaccccagcattcttccagatccagggagatccagaggttgagggggcatatccc
agcctcaatgtgaccttcaactctaggacaatgaacctaagctgggactgcccagagaac
atgactgaagccaggtgcttgctgagacatgaggagacagggaaaatcatcatgaaggtc
tcccggatgggatgcagctgcaccttcacctccatgacactgcatgcgggagccacactc
gaggtccaggtgacagctcatcagagacacctgcgtgagactctggtctatgccaacaca
ggcgtggagggcacggccgccaggaacttctcctgcttcatctacgatgccgatttcctg
aactgcacctgggctcgggggccagttgcccccgtggatacccaatacttcctgtttctg
caggattctaggagccaaggcaagagggaaacagaatgccccgggtacctgaaggaggcg
ggcacgaacctgggctgccacctacacggcctgtccaggtggcccttctacacctacttc
ctggtcaatggcagcagccggcacatgcacatccagttcttcgatgccatactatccacc
aaagaaatagaacgcttcagccctccggccaacaccagtgtccactgcaacgagtcccac
tgcctgatccagtggctgcagcccaagacccagcagcggctgtcatatctggacttccaa
taccagctggacatccagaaggaggtctgtggtgtctcctcagaggtccctaagaacatg
gaacctggcagctggaaccccctggttgaagtatctggtgcatcagagaacaaatacaac
ttccccagcctgcagcccagagtcaggcactgggtgcgggtccgagctgcggatgccagg
gtcctgggctggagcccctggagccagcctgtgcactttggctctgacacagaggatggc
ggcctgctgcgtgtgtccctgcttgtggtcttggggacccttgtctgcacccttgtgttg
ggctttctcgctaaaaggttcttcaaaatgtgtggcctcttgtcaccaatcccgcatgtg
aaagacaaattgaatgaccagcaggatcttgagcaccaggttgcctgggacgagttccca
gtgggttccggtaaatgtgagaatgaggaggtgctgacagtacaggacgctggacaggcc
ttgggggccagagcatga

DBGET integrated database retrieval system