Oryctolagus cuniculus (rabbit): 100347345 Help Entry 100347345         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu01524   Platinum drug resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04066   HIF-1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04114   Oocyte meiosis ocu04140   Autophagy - animal ocu04148   Efferocytosis ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04270   Vascular smooth muscle contraction ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04371   Apelin signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04520   Adherens junction ocu04540   Gap junction ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04666   Fc gamma R-mediated phagocytosis ocu04668   TNF signaling pathway ocu04713   Circadian entrainment ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04724   Glutamatergic synapse ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04730   Long-term depression ocu04810   Regulation of actin cytoskeleton ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04917   Prolactin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04929   GnRH secretion ocu04930   Type II diabetes mellitus ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04934   Cushing syndrome ocu04935   Growth hormone synthesis, secretion and action ocu04960   Aldosterone-regulated sodium reabsorption ocu05010   Alzheimer disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05034   Alcoholism ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100347345    04015 Rap1 signaling pathway     100347345    04350 TGF-beta signaling pathway     100347345    04668 TNF signaling pathway     100347345    04066 HIF-1 signaling pathway     100347345    04068 FoxO signaling pathway     100347345    04072 Phospholipase D signaling pathway     100347345    04071 Sphingolipid signaling pathway     100347345    04024 cAMP signaling pathway     100347345    04022 cGMP-PKG signaling pathway     100347345    04151 PI3K-Akt signaling pathway     100347345    04150 mTOR signaling pathway     100347345  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100347345    04148 Efferocytosis     100347345   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100347345  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100347345    04613 Neutrophil extracellular trap formation     100347345    04620 Toll-like receptor signaling pathway     100347345    04650 Natural killer cell mediated cytotoxicity     100347345    04660 T cell receptor signaling pathway     100347345    04658 Th1 and Th2 cell differentiation     100347345    04659 Th17 cell differentiation     100347345    04657 IL-17 signaling pathway     100347345    04662 B cell receptor signaling pathway     100347345    04664 Fc epsilon RI signaling pathway     100347345    04666 Fc gamma R-mediated phagocytosis     100347345    04062 Chemokine signaling pathway     100347345   09152 Endocrine system    04929 GnRH secretion     100347345    04915 Estrogen signaling pathway     100347345    04917 Prolactin signaling pathway     100347345    04921 Oxytocin signaling pathway     100347345    04926 Relaxin signaling pathway     100347345    04935 Growth hormone synthesis, secretion and action     100347345    04919 Thyroid hormone signaling pathway     100347345    04928 Parathyroid hormone synthesis, secretion and action     100347345   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100347345   09156 Nervous system    04724 Glutamatergic synapse     100347345    04725 Cholinergic synapse     100347345    04726 Serotonergic synapse     100347345    04720 Long-term potentiation     100347345    04730 Long-term depression     100347345    04723 Retrograde endocannabinoid signaling     100347345    04722 Neurotrophin signaling pathway     100347345   09158 Development and regeneration    04360 Axon guidance     100347345    04380 Osteoclast differentiation     100347345   09159 Environmental adaptation    04713 Circadian entrainment     100347345  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100347345    05206 MicroRNAs in cancer     100347345    05205 Proteoglycans in cancer     100347345    05207 Chemical carcinogenesis - receptor activation     100347345    05208 Chemical carcinogenesis - reactive oxygen species     100347345    05203 Viral carcinogenesis     100347345    05230 Central carbon metabolism in cancer     100347345    05231 Choline metabolism in cancer     100347345    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100347345   09162 Cancer: specific types    05210 Colorectal cancer     100347345    05212 Pancreatic cancer     100347345    05225 Hepatocellular carcinoma     100347345    05226 Gastric cancer     100347345    05214 Glioma     100347345    05216 Thyroid cancer     100347345    05221 Acute myeloid leukemia     100347345    05220 Chronic myeloid leukemia     100347345    05218 Melanoma     100347345    05211 Renal cell carcinoma     100347345    05219 Bladder cancer     100347345    05215 Prostate cancer     100347345    05213 Endometrial cancer     100347345    05224 Breast cancer     100347345    05223 Non-small cell lung cancer     100347345   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100347345    05170 Human immunodeficiency virus 1 infection     100347345    05161 Hepatitis B     100347345    05160 Hepatitis C     100347345    05171 Coronavirus disease - COVID-19     100347345    05164 Influenza A     100347345    05163 Human cytomegalovirus infection     100347345    05167 Kaposi sarcoma-associated herpesvirus infection     100347345    05165 Human papillomavirus infection     100347345   09171 Infectious disease: bacterial    05135 Yersinia infection     100347345    05133 Pertussis     100347345    05152 Tuberculosis     100347345   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100347345    05140 Leishmaniasis     100347345    05142 Chagas disease     100347345   09164 Neurodegenerative disease    05010 Alzheimer disease     100347345    05020 Prion disease     100347345    05022 Pathways of neurodegeneration - multiple diseases     100347345   09165 Substance dependence    05034 Alcoholism     100347345   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100347345   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100347345    04933 AGE-RAGE signaling pathway in diabetic complications     100347345    04934 Cushing syndrome     100347345   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100347345    01524 Platinum drug resistance     100347345    01522 Endocrine resistance     100347345  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100347345   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100347345   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100347345 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100347345 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100347345 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100347345 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100347345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase Choline_kinase FTA2 Kdo Motif Other DBs NCBI-GeneID:  100347345 NCBI-ProteinID:  XP_051682699 LinkDB All DBs Position 21:complement(6079552..6183400) Genome browser AA seq 360 aa AA seqDB search MAAAAAAGTGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggcgggcacgggcccggagatggtccgcgggcaggtgttcgac gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc tctgcttatgataatgtcaacaaagttcgagtggctatcaagaaaatcagtccttttgag caccagacctactgccagcgaaccctgagggagataaaaatcttactgcgcttcagacat gagaacatcattggaatcaatgacattattcgagccccaaccattgagcagatgaaagat gtatacatagtccaggacctcatggaaacagatctttacaagctcttgaagacacagcac ctcagcaacgaccatatctgctattttctctaccagatcctcagagggttaaaatacatc cattcagccaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc tgtgatctcaagatctgtgacttcggcctggcccgcgttgcggatccggaccatgatcac acagggttcctgacagagtatgtagccacgcgttggtacagggctccagaaattatgctg aattccaagggctacaccaagtccatcgacatctggtctgtaggctgcatcctggcggag atgctctccaacagacccatcttcccggggaagcactacctggaccagctgaaccacatt ctgggtattcttggatccccttcacaagaagacctgaattgtataataaacttaaaagcc agaaactatttgctttctcttccacacaaaaacaaggtgccatggaacaggctgtttcca aatgctgactccaaagctctggacttgctggacaagatgttgactttcaaccctcacaag aggatcgaagtagagcaggccctggcccacccctacctggagcagtattacgacccgagt gacgagcccatcgccgaagctccattcaagttcgacatggaattggatgacttgcctaag gaaaagctcaaagaactcatttttgaagagactgcgagattccagccaggatacagatct taa

Oryctolagus cuniculus (rabbit): 100348561 Help Entry 100348561         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu01524   Platinum drug resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04066   HIF-1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04114   Oocyte meiosis ocu04140   Autophagy - animal ocu04148   Efferocytosis ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04270   Vascular smooth muscle contraction ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04371   Apelin signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04520   Adherens junction ocu04540   Gap junction ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04666   Fc gamma R-mediated phagocytosis ocu04668   TNF signaling pathway ocu04713   Circadian entrainment ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04724   Glutamatergic synapse ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04730   Long-term depression ocu04810   Regulation of actin cytoskeleton ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04917   Prolactin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04929   GnRH secretion ocu04930   Type II diabetes mellitus ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04934   Cushing syndrome ocu04935   Growth hormone synthesis, secretion and action ocu04960   Aldosterone-regulated sodium reabsorption ocu05010   Alzheimer disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05034   Alcoholism ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100348561    04015 Rap1 signaling pathway     100348561    04350 TGF-beta signaling pathway     100348561    04668 TNF signaling pathway     100348561    04066 HIF-1 signaling pathway     100348561    04068 FoxO signaling pathway     100348561    04072 Phospholipase D signaling pathway     100348561    04071 Sphingolipid signaling pathway     100348561    04024 cAMP signaling pathway     100348561    04022 cGMP-PKG signaling pathway     100348561    04151 PI3K-Akt signaling pathway     100348561    04150 mTOR signaling pathway     100348561  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100348561    04148 Efferocytosis     100348561   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100348561  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100348561    04613 Neutrophil extracellular trap formation     100348561    04620 Toll-like receptor signaling pathway     100348561    04650 Natural killer cell mediated cytotoxicity     100348561    04660 T cell receptor signaling pathway     100348561    04658 Th1 and Th2 cell differentiation     100348561    04659 Th17 cell differentiation     100348561    04657 IL-17 signaling pathway     100348561    04662 B cell receptor signaling pathway     100348561    04664 Fc epsilon RI signaling pathway     100348561    04666 Fc gamma R-mediated phagocytosis     100348561    04062 Chemokine signaling pathway     100348561   09152 Endocrine system    04929 GnRH secretion     100348561    04915 Estrogen signaling pathway     100348561    04917 Prolactin signaling pathway     100348561    04921 Oxytocin signaling pathway     100348561    04926 Relaxin signaling pathway     100348561    04935 Growth hormone synthesis, secretion and action     100348561    04919 Thyroid hormone signaling pathway     100348561    04928 Parathyroid hormone synthesis, secretion and action     100348561   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100348561   09156 Nervous system    04724 Glutamatergic synapse     100348561    04725 Cholinergic synapse     100348561    04726 Serotonergic synapse     100348561    04720 Long-term potentiation     100348561    04730 Long-term depression     100348561    04723 Retrograde endocannabinoid signaling     100348561    04722 Neurotrophin signaling pathway     100348561   09158 Development and regeneration    04360 Axon guidance     100348561    04380 Osteoclast differentiation     100348561   09159 Environmental adaptation    04713 Circadian entrainment     100348561  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100348561    05206 MicroRNAs in cancer     100348561    05205 Proteoglycans in cancer     100348561    05207 Chemical carcinogenesis - receptor activation     100348561    05208 Chemical carcinogenesis - reactive oxygen species     100348561    05203 Viral carcinogenesis     100348561    05230 Central carbon metabolism in cancer     100348561    05231 Choline metabolism in cancer     100348561    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100348561   09162 Cancer: specific types    05210 Colorectal cancer     100348561    05212 Pancreatic cancer     100348561    05225 Hepatocellular carcinoma     100348561    05226 Gastric cancer     100348561    05214 Glioma     100348561    05216 Thyroid cancer     100348561    05221 Acute myeloid leukemia     100348561    05220 Chronic myeloid leukemia     100348561    05218 Melanoma     100348561    05211 Renal cell carcinoma     100348561    05219 Bladder cancer     100348561    05215 Prostate cancer     100348561    05213 Endometrial cancer     100348561    05224 Breast cancer     100348561    05223 Non-small cell lung cancer     100348561   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100348561    05170 Human immunodeficiency virus 1 infection     100348561    05161 Hepatitis B     100348561    05160 Hepatitis C     100348561    05171 Coronavirus disease - COVID-19     100348561    05164 Influenza A     100348561    05163 Human cytomegalovirus infection     100348561    05167 Kaposi sarcoma-associated herpesvirus infection     100348561    05165 Human papillomavirus infection     100348561   09171 Infectious disease: bacterial    05135 Yersinia infection     100348561    05133 Pertussis     100348561    05152 Tuberculosis     100348561   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100348561    05140 Leishmaniasis     100348561    05142 Chagas disease     100348561   09164 Neurodegenerative disease    05010 Alzheimer disease     100348561    05020 Prion disease     100348561    05022 Pathways of neurodegeneration - multiple diseases     100348561   09165 Substance dependence    05034 Alcoholism     100348561   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100348561   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100348561    04933 AGE-RAGE signaling pathway in diabetic complications     100348561    04934 Cushing syndrome     100348561   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100348561    01524 Platinum drug resistance     100348561    01522 Endocrine resistance     100348561  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100348561   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100348561   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100348561 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100348561 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100348561 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100348561 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100348561 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo Motif Other DBs NCBI-GeneID:  100348561 NCBI-ProteinID:  XP_051703542 Ensembl:  ENSOCUG00000013716 LinkDB All DBs Position 6:complement(18466143..18472024) Genome browser AA seq 380 aa AA seqDB search MAAAAAAQGGGGGEPRGADGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSA YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFSHENVIGIRDILRAPTLEAMRDVY IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPAKTKVAWAKLFPKS DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER LKELIFQETARFQPGAPEGP NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggagccgatggg gtcggcccgggggtccccggggaagtggaggtcgtgaaggggcagccgttcgacgtgggc ccacgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagcc tatgaccacgtgcgcaagacccgcgtggccatcaagaagatcagtcccttcgaacaccag acctactgccagcgcacgctgagggagatccagatcctgctacgcttctcccatgagaac gtcatcggcatccgggacattcttcgggctcccaccctggaagccatgagggatgtctac atcgtgcaggacctcatggagacagacctgtacaagttgctcaaaagccagcaactaagc aacgaccacatctgctacttcctctaccagatcctgcggggtctcaagtacatccactcg gccaacgtgctccaccgggacctgaagccctccaacctgctcatcaacaccacctgcgac cttaagatctgtgatttcggcctggcccgcattgcagaccctgaacatgaccacaccggc ttcctgacggagtacgtggccacgcgctggtaccgggccccagagatcatgctcaactcc aagggctatactaagtccatcgacatctggtctgtgggctgcatcctggccgagatgctc tccaaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctaggc atcctgggctcgccgtcccaggaggacctgaactgcatcatcaacatgaaggcccggaac tacctgcagtccctgcctgccaagaccaaggtggcctgggccaagctgtttcccaagtca gactccaaagccctggacctgctggatcggatgttgaccttcaaccccaacaagcgcatc actgtggaggaggccctggctcacccctacctggaacagtactatgacccgacggacgag ccggtggccgaggagcccttcaccttcgacatggagttggatgatctacccaaggagcgg ctgaaggagctcatcttccaggagacggcccgcttccagccgggggctccggaggggccc tag

DBGET integrated database retrieval system