KEGG   Oryctolagus cuniculus (rabbit): 100347876
Entry
100347876         CDS       T03373                                 
Symbol
TNFSF14
Name
(RefSeq) tumor necrosis factor superfamily member 14
  KO
K05477  tumor necrosis factor ligand superfamily member 14
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04064  NF-kappa B signaling pathway
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100347876 (TNFSF14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100347876 (TNFSF14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100347876 (TNFSF14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100347876 (TNFSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100347876 (TNFSF14)
   04090 CD molecules [BR:ocu04090]
    100347876 (TNFSF14)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100347876 (TNFSF14)
CD molecules [BR:ocu04090]
 Proteins
  100347876 (TNFSF14)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100347876
NCBI-ProteinID: NP_001316015
UniProt: I1SR88
LinkDB
Position
Un
AA seq 241 aa
MEETVVRPSVFVVDGQTDIPFTRLGRRRRRQRCGAAQVGLGLVLLLLGAGLAVQGWFLLQ
LHWRLGEMVTHLPDQDTGSWEQLVQARRSHKASPAAHLTGANSSSMGTGGPLLWETQLGL
AFLRGLGYHDGALVTTQAGYYYIYSKVQLGGVGCPQGLATDLPVTHGLYKRTTRYPEELE
LLVSRRSPCGRAASSRVWWDSSFLGGVVHLEAGEEVVVRVLEEQLVRLRDGTRSYFGAFM
V
NT seq 726 nt   +upstreamnt  +downstreamnt
atggaggagaccgtagtgcgcccctcggtgttcgtggtggatggacagacggacatcccg
ttcacgaggctggggcggagacgccggagacagcgctgcggcgctgcccaggtgggcctg
ggcctcgtgctgctgctgctgggagccgggctggccgtgcagggctggttcctattacag
ctgcactggcgcctgggggagatggtcacgcacctgccggaccaagacacaggctcctgg
gagcagctggtacaagcacgcaggtcccacaaggccagtccagcggcgcatctcacaggc
gccaactccagctccatgggcaccgggggccccctgctgtgggagacgcagctgggcctg
gccttcctgcggggcctcggctaccacgacggggcgctggtgaccacccaggccggctac
tactacatctactccaaggtgcagctgggcggcgtgggatgcccgcagggcctggccacc
gacctgcccgtcacccacgggctctacaagcgcaccacccgctaccccgaggagctcgag
ctgctggtgagccggcggtcgccctgcgggcgggcggccagctcccgcgtctggtgggac
agcagcttcctgggcggcgtggtgcacctggaggccggcgaggaggtggtggtccgcgtg
ctggaagagcagctggtccggctccgggacggcacccgctcctacttcggcgctttcatg
gtgtga

DBGET integrated database retrieval system