KEGG   Oryctolagus cuniculus (rabbit): 100348021
Entry
100348021         CDS       T03373                                 
Symbol
RAB5C
Name
(RefSeq) RAB5C, member RAS oncogene family
  KO
K07889  Ras-related protein Rab-5C
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04962  Vasopressin-regulated water reabsorption
ocu05132  Salmonella infection
ocu05146  Amoebiasis
ocu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100348021 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100348021 (RAB5C)
   04145 Phagosome
    100348021 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100348021 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100348021 (RAB5C)
   05152 Tuberculosis
    100348021 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100348021 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100348021 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100348021 (RAB5C)
   04031 GTP-binding proteins [BR:ocu04031]
    100348021 (RAB5C)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100348021 (RAB5C)
 Endosome - Lysosome transport
    100348021 (RAB5C)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100348021 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   100348021 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   100348021 (RAB5C)
  Exosomal proteins of bladder cancer cells
   100348021 (RAB5C)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100348021 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 100348021
NCBI-ProteinID: XP_002719438
Ensembl: ENSOCUG00000013307
UniProt: G1T550
LinkDB
Position
19:complement(42956632..42982445)
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQSAAGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggcgcagcgcgacccaatggaccggccgccgggaacaagatctgt
cagttcaagctggtcctgctgggggagtctgcggtgggcaagtccagccttgtcctccgc
tttgtcaaggggcagtttcacgagtaccaggagagcacaattggagcggccttcctcaca
cagacagtctgcttggacgacacaacggtgaagtttgagatttgggacacagcgggacag
gagcggtaccacagcctcgctcccatgtattaccggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagacacattcgcacgggccaagaactgggtgaaggagttgcag
aggcaggccagccccaatatcgtcatcgcgctcgccggcaacaaggcggacctggccagc
aagagagccgtggagttccaggaagcacaagcctatgcagatgacaacagtttgctgttc
atggagacatcagcaaagactgccatgaacgtgaatgaaattttcatggcgatagctaag
aagcttcccaagaatgagccccagagtgcggctggtgctccaggccggaaccggggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

KEGG   Oryctolagus cuniculus (rabbit): 100348306
Entry
100348306         CDS       T03373                                 
Symbol
RAB5B
Name
(RefSeq) RAB5B, member RAS oncogene family
  KO
K07888  Ras-related protein Rab-5B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04962  Vasopressin-regulated water reabsorption
ocu05132  Salmonella infection
ocu05146  Amoebiasis
ocu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100348306 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100348306 (RAB5B)
   04145 Phagosome
    100348306 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100348306 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100348306 (RAB5B)
   05152 Tuberculosis
    100348306 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100348306 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100348306 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100348306 (RAB5B)
   04031 GTP-binding proteins [BR:ocu04031]
    100348306 (RAB5B)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100348306 (RAB5B)
 Endosome - Lysosome transport
    100348306 (RAB5B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100348306 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   100348306 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   100348306 (RAB5B)
  Exosomal proteins of melanoma cells
   100348306 (RAB5B)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100348306 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 100348306
NCBI-ProteinID: XP_002711110
Ensembl: ENSOCUG00000013895
LinkDB
Position
4:39524307..39544725
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagcacagccaggcccaatgggcagcctcaagccagcaaaatatgccaa
ttcaaattggtcctgctgggggaatctgcggtgggaaaatctagtctggtattacgattt
gtcaaagggcaattccacgaataccaggagagtaccattggagcggccttcctcacccag
tctgtttgtctagatgatacaacagtcaagtttgagatctgggacacagctgggcaagag
cgataccacagcttagctcccatgtactacaggggtgcccaagctgcgattgttgtttat
gacattactaatcaggaaacatttgcccgagcaaagacatgggtaaaggaactacagagg
caggccagtcctagcatcgttattgccctggcggggaacaaagctgacctggccaacaag
cgcatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgtttatg
gagacttcagccaagacggctatgaacgtgaacgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggcgtggat
cttcatgagcagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Oryctolagus cuniculus (rabbit): 100350923
Entry
100350923         CDS       T03373                                 
Symbol
RAB5A
Name
(RefSeq) RAB5A, member RAS oncogene family
  KO
K07887  Ras-related protein Rab-5A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04962  Vasopressin-regulated water reabsorption
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05146  Amoebiasis
ocu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100350923 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350923 (RAB5A)
   04145 Phagosome
    100350923 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100350923 (RAB5A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100350923 (RAB5A)
   05152 Tuberculosis
    100350923 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100350923 (RAB5A)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100350923 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100350923 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350923 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100350923 (RAB5A)
   04031 GTP-binding proteins [BR:ocu04031]
    100350923 (RAB5A)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100350923 (RAB5A)
 Endosome - Lysosome transport
    100350923 (RAB5A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100350923 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   100350923 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   100350923 (RAB5A)
  Exosomal proteins of bladder cancer cells
   100350923 (RAB5A)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100350923 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 100350923
NCBI-ProteinID: XP_002716250
Ensembl: ENSOCUG00000012200
UniProt: G1T2T9
LinkDB
Position
14:6021718..6055019
AA seq 215 aa
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGGNSARGRGVDLTEPTQPTRSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtgtgtcttgatgacacaacagtaaagtttgaaatctgggatacagctggtcaagag
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatcgttgtctac
gacattacaaatgaggaatcctttgcaagagcaaaaaactgggttaaagagcttcagagg
caagcaagtcctaacattgtaatagcattatcaggaaacaaggctgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg
gagacatcagctaaaacatcgatgaatgtaaatgaaatattcatggcaatagctaaaaag
ttgccaaagaatgaaccacagaatccaggaggaaattctgctagaggaagaggagtagac
cttactgaacctacacaaccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system